KEGG   Synechocystis sp. PCC 6803: slr0012Help
Entry
slr0012           CDS       T00004                                 

Gene name
rbcS
Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00630  Glyoxylate and dicarboxylate metabolism
syn00710  Carbon fixation in photosynthetic organisms
syn01100  Metabolic pathways
syn01120  Microbial metabolism in diverse environments
syn01200  Carbon metabolism
Module
syn_M00165  Reductive pentose phosphate cycle (Calvin cycle)
syn_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
syn_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    slr0012 (rbcS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    slr0012 (rbcS)
Enzymes [BR:syn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     slr0012 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: BAA10192
CyanoBase: slr0012
CYORF: slr0012
UniProt: P54206
LinkDB All DBs
Position
2480477..2480818
Genome map
AA seq 113 aa AA seqDB search
MKTLPKERRYETLSYLPPLTDQQIAKQVEFLLDQGFIPGVEFEEDPQPETHFWTMWKLPF
FGGATANEVLAEVRECRSENPNCYIRVIGFDNIKQCQTVSFIVHKPNQNQGRY
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttacccaaagagcgccgctacgaaaccctttcttacctgccccctttaacc
gatcaacagattgctaaacaggttgagtttctgttagaccagggctttattcccggcgtg
gaatttgaagaagacccccaacccgaaacccacttctggaccatgtggaaactgcccttc
tttggtggtgccactgccaacgaagttctagccgaagtacgggaatgtcgttctgagaat
cccaactgctacattcgggtgattggtttcgacaatatcaaacagtgccagactgtaagc
tttattgtccacaaacccaaccaaaaccaaggccgttactaa

DBGET integrated database retrieval system