KEGG   Synechocystis sp. PCC 6803: slr0091Help
Entry
slr0091           CDS       T00004                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00010  Glycolysis / Gluconeogenesis
syn00053  Ascorbate and aldarate metabolism
syn00071  Fatty acid degradation
syn00280  Valine, leucine and isoleucine degradation
syn00310  Lysine degradation
syn00330  Arginine and proline metabolism
syn00340  Histidine metabolism
syn00380  Tryptophan metabolism
syn00410  beta-Alanine metabolism
syn00561  Glycerolipid metabolism
syn00620  Pyruvate metabolism
syn00625  Chloroalkane and chloroalkene degradation
syn01100  Metabolic pathways
syn01110  Biosynthesis of secondary metabolites
syn01120  Microbial metabolism in diverse environments
syn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    slr0091
   00053 Ascorbate and aldarate metabolism
    slr0091
   00620 Pyruvate metabolism
    slr0091
  Lipid metabolism
   00071 Fatty acid degradation
    slr0091
   00561 Glycerolipid metabolism
    slr0091
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    slr0091
   00310 Lysine degradation
    slr0091
   00330 Arginine and proline metabolism
    slr0091
   00340 Histidine metabolism
    slr0091
   00380 Tryptophan metabolism
    slr0091
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    slr0091
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    slr0091
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    slr0091
Enzymes [BR:syn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     slr0091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh UvsY
Motif
Other DBs
NCBI-ProteinID: BAA10564
CyanoBase: slr0091
CYORF: slr0091
UniProt: Q55811
LinkDB All DBs
Position
2898710..2900080
Genome map
AA seq 456 aa AA seqDB search
MNTAKTVVAEQRDFFRQGKTKSVQDRLTALAKLKTQIQAQEEEIIKALKQDFGKPTFESY
VNEILGVIREINYYQKHLQQWSKPQRVGTNLMVFPASAQLRPEPLGVVLIISPWNYPFYL
CLMPLIGAIAAGNCVVVKPSEYTPAISGVITRLIQNVFSPAWATVVEGDETISQQLLQEK
FDHIFFTGSPRVGRLIMAAAAEQLTPVTLELGGKSPCVVDREINLQETAKRIMWGKLVNA
GQTCVAPDYLLVEQSCLEQLLPALQQAIQMLFGENPAHSPDYTRIVNQQQWSRLVSLLSH
GKVITRGDHNEGDRYIAPTLIIDPDLNSPLMQEEIFGPILPILTYQSLSEAIDFINIKPK
PLALYFFSNNRQKQEEILQSTSSGSVCLNDILLHLTVTDLPFGGVGESGMGRYHGKATFD
TLSNYKSILRRPFWGETNLRYSPYGKKMNLIKKLFS
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgctaaaactgttgttgctgagcaaagggacttttttcgtcagggcaaaact
aaatcagtccaagatagattaacagctctagcaaaattaaaaacgcaaattcaagcccag
gaagaggaaattattaaggcccttaagcaagattttggtaagcccacctttgaaagctat
gtaaacgaaattttgggggtaattagggaaattaattattatcaaaaacatcttcagcaa
tggtctaagccccaacgggtaggtacgaatctgatggtttttcctgccagtgcccagtta
agaccagaaccccttggtgtagtgctaattattagcccctggaattatcctttttatctt
tgtttaatgcccttgatcggggcgatcgccgctggaaattgtgtggtggtaaagccgtcg
gaatatactccagctattagtggggtaattaccagattaatccaaaatgtattttccccg
gcttgggcaacagtggtggagggagatgaaaccattagccaacaattgttacaggaaaaa
tttgaccatattttctttaccggcagccctagggtgggtcggttaattatggcagctgcg
gcagagcaattaaccccagttacgttggaattggggggtaaatctccctgtgtggtggat
agggaaatcaacctccaggaaacagccaaacgcattatgtggggcaagctagtcaatgct
ggccaaacctgtgtggcaccggattatttattggtggagcaatcctgcttagaacaactt
ttaccagctttacaacaggcaattcagatgcttttcggggaaaatccagcccatagccct
gactacactcgcattgttaaccaacaacaatggtcacggttagttagtttattaagccat
ggcaaagtaattacaaggggagatcataacgaaggcgatcgctacattgccccaacttta
atcatcgatccagatttaaattctcccttaatgcaagaggaaatatttggcccaattttg
ccaattttaacttatcagagtttgtcagaagcaatagattttattaacatcaaacctaaa
ccattggcactttatttttttagcaataatcggcaaaaacaggaggaaattttgcaatct
accagttccggtagtgtttgtttgaacgatattttgcttcatttaactgtgacagactta
ccctttggtggggtgggagaaagtggtatgggacgctaccatggcaaggctacttttgac
acattgagcaattataaaagcattttacgacgacccttttggggggaaactaatttacgc
tattctccctatggcaaaaaaatgaatttaatcaaaaagttgttctcctag

DBGET integrated database retrieval system