KEGG   Synechocystis sp. PCC 6803: slr1874Help
Entry
slr1874           CDS       T00004                                 

Gene name
ddlA
Definition
(GenBank) D-alanine:D-alanine ligase-related protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00473  D-Alanine metabolism
syn00550  Peptidoglycan biosynthesis
syn01100  Metabolic pathways
syn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    slr1874 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    slr1874 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    slr1874 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:syn01011]
    slr1874 (ddlA)
Enzymes [BR:syn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     slr1874 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:syn01011]
 Precursor biosynthesis
  Amino acid ligase
   slr1874 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: BAA17677
CyanoBase: slr1874
CYORF: slr1874
UniProt: P73632
LinkDB All DBs
Position
1224777..1225841
Genome map
AA seq 354 aa AA seqDB search
MRVGLLFGGCSGEHEVSIKSAQAIAKALASDDNQTKYQVSPFYIQKNGVWLGPDVSQQVL
DQGVPWGDQPVTAGQRWQFPPEAARMEVWFPILHGPNGEDGTVQGLFSLMQVPYVGSGVL
GSCVGMDKLAMKMVFERAGLPQVNYMGVERGEIWSNPCVFPALCEKIEAQVGYPCFVKPA
NLGSSVGIAKVRNRSELEAALDNAASYDRRIIVEAGLTDIREVECAVLGNENPQASVVGE
ITYDSDFYDYETKYTDGRSQMHIPANLPKAVVNQIQTMAIQAFKAVDAAGLGRLDFFYQP
TTGQIVINEINTLPGFTAFSMYPELWRASGVEFPSLVDRLLQLALDYHGRPGHQ
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtggggctgttatttggtgggtgttctggggagcatgaagtctcgatcaaatcc
gcccaggcgatcgccaaagcattggccagcgacgataaccaaaccaaatatcaagtaagc
cctttttatattcaaaaaaatggcgtttggctggggccagacgtttctcaacaggttttg
gaccagggagttccctggggggatcagcccgttacggccggacaacggtggcagtttccc
cccgaagcggcccgaatggaggtgtggtttcccattttgcacggccccaacggtgaagat
ggcacagtgcaggggttatttagtttgatgcaagtgccctatgtgggcagtggcgtgctg
ggttcctgtgtgggcatggataaattggcgatgaaaatggtctttgaacgggcagggttg
ccccaggtcaattacatgggggtagaacggggggaaatttggtctaatccctgtgttttt
ccggctttgtgcgaaaaaattgaagcccaggtgggctatccctgtttcgttaaaccggcc
aacttaggctcctccgtgggcattgccaaagtgcggaaccgtagtgaattggaagcagcc
ctagacaacgccgccagttacgatcgccgcatcattgtcgaagcgggtttaacggatatt
agggaagtggaatgtgcggtgctgggcaacgaaaatccccaagcttccgtggtgggggaa
atcacctacgacagcgacttttacgattacgaaaccaaatacaccgatggccgctcccaa
atgcatatccccgccaacttacctaaagctgtggtgaaccagatccagaccatggccatt
caagcttttaaagctgtggatgcggcgggcttaggacgattggactttttctatcaaccg
actacggggcagattgtcatcaacgaaattaacaccctgcctggtttcaccgcctttagt
atgtatcccgaactgtggcgagcttctggggtagaatttcctagcttagtggatcgatta
ttacagttggcattggactaccatggccgtcccggtcaccaataa

DBGET integrated database retrieval system