KEGG   Synechococcus sp. CB0101: CB0101_06380
Entry
CB0101_06380      CDS       T06409                                 

Definition
(GenBank) 2-oxo acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sync  Synechococcus sp. CB0101
Pathway
sync00010  Glycolysis / Gluconeogenesis
sync00020  Citrate cycle (TCA cycle)
sync00620  Pyruvate metabolism
sync01100  Metabolic pathways
sync01110  Biosynthesis of secondary metabolites
sync01120  Microbial metabolism in diverse environments
sync01200  Carbon metabolism
Module
sync_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sync00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CB0101_06380
   00020 Citrate cycle (TCA cycle)
    CB0101_06380
   00620 Pyruvate metabolism
    CB0101_06380
Enzymes [BR:sync01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CB0101_06380
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Other DBs
NCBI-ProteinID: QCH14592
UniProt: A0A4P7ZSE6
LinkDB
Position
complement(1175221..1176540)
AA seq 439 aa
MATHEIFMPALSSTMTEGKIVEWLKKPGDKVERGESVLVVESDKADMDVESFNEGYLAAV
LMPAGGTAPVGETIGLIVETQAEIAEVQAKAPSGGAAAAPAAAAAPAPAPAAAPAPVAAA
PAPVVAAAPVPVASGRVVASPRAKKLASQHGVALETMRGSGPHGRIQAEDVERALGLTVA
VPRVAEGSAPAAAASGNGAAAPAPAPAGDAFGRPGESVSFNTLQNAVNRNMIASLEVPCF
RVGYTITTTKLDALYKQVKSKGVTMTALLAKAVGVVLARHPQVNAATSADGSAMSFPAAV
NVAVAVAMEDGGLITPVLANADKTDIYSLARNWADLVSRARSKQLQPEEYSTGTFTLSNL
GMFGVDRFDAILPPGTGAILAVAASRPTVVAGKDGSMRVANQMQVNLTCDHRVIYGAHAA
AFLKDLAQLIETNPESLAI
NT seq 1320 nt   +upstreamnt  +downstreamnt
ttggccacccacgaaatctttatgcccgccctctcctccaccatgacggaggggaagatc
gtggagtggctcaaaaagcctggcgacaaggtggagcggggtgagtcggtgctcgtggtc
gagtccgacaaggccgatatggatgtggagtcgttcaacgagggctatctcgccgccgtg
ttgatgccggccggtggcacggccccggtgggcgaaaccatcggcctgatcgtggaaacc
caggcggagatcgctgaggttcaggccaaggcccccagtggtggtgcggcggcggctccc
gctgcggccgcggctcctgcgcctgctccggccgctgcccccgcgccagtggccgcagct
ccagcacccgttgtcgctgccgcccctgttcccgtggccagcggccgggtggtggccagc
ccccgcgccaagaagctcgccagccagcacggcgtggcgctcgaaaccatgcgtggcagc
ggcccccacggccgcattcaggctgaagacgtggaacgggccctcggtctcaccgtggct
gtgccccgcgtggcggagggatcagcccctgcggctgccgcctcaggcaatggcgccgct
gcgccggctcccgcacccgccggtgacgcgtttggacgccccggcgagagcgtgagcttc
aacacgctgcagaacgcggtcaaccgcaacatgatcgccagcctggaggtgccttgcttc
cgggtgggctacacgatcaccaccaccaagctcgacgccttatacaagcaggtgaagagc
aagggcgtgaccatgacggccctgttggccaaggccgtgggtgtggtcctggcccgtcac
ccccaggtgaatgccgccaccagcgccgatggcagcgccatgagcttccccgctgctgtg
aatgtggctgtggctgtggctatggaagacggcggtctgatcacccctgtgctcgccaac
gccgacaagaccgatatctattcgttggcgcgcaactgggctgatctggtgagccgcgcc
cgcagcaagcagcttcagcccgaggaatacagcaccggcaccttcaccctctccaacctg
gggatgttcggtgtggatcgcttcgacgcgatcctgccccctggcaccggcgccatcctg
gctgtcgccgcctcccgccccaccgttgtggcaggtaaggatggctcgatgcgcgtggcc
aaccagatgcaggtgaacctcacctgtgatcaccgcgtgatctatggcgcccacgcggca
gccttcctcaaggatctggcccagctgatcgaaaccaaccccgaaagcctggcgatctga

DBGET integrated database retrieval system