KEGG   Synechococcus sp. KORDI-52: KR52_06275Help
Entry
KR52_06275        CDS       T03346                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
synd  Synechococcus sp. KORDI-52
Pathway
synd00010  Glycolysis / Gluconeogenesis
synd00020  Citrate cycle (TCA cycle)
synd00620  Pyruvate metabolism
synd01100  Metabolic pathways
synd01110  Biosynthesis of secondary metabolites
synd01120  Microbial metabolism in diverse environments
synd01130  Biosynthesis of antibiotics
synd01200  Carbon metabolism
Module
synd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:synd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KR52_06275
   00020 Citrate cycle (TCA cycle)
    KR52_06275
   00620 Pyruvate metabolism
    KR52_06275
Enzymes [BR:synd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     KR52_06275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AII48748
UniProt: A0A076HI41
LinkDB All DBs
Position
1187192..1188523
Genome map
AA seq 443 aa AA seqDB search
MATTDIFMPALSSTMTEGKIVEWLKQPGDKVARGESVLVVESDKADMDVESFQDGYLAAV
LMPAGSTAPVGETIGLIVETEAEIADAQAKAPSAPAAASAPAPAPAPAPTPAAVQAPAPT
PAPAPAPVAPPAPSAPVVNDGRIVASPRAKKLASQMGVDLATVRGSGPHGRIQAEDVEQA
TGQPISVPRVAEGTAPAAAAGGAAAAVAPAAPAGNSFGRPGETVAFTTLQGAVNKNMEAS
LAVPCFRVGYTITTDKLDAFYKQVKPKGVTMTALLAKAVAVTLARHPQVNAATTAAGMAY
PADVNVAVAVAMGDGGLITPVLRNADRTDLYEMSRQWGDLVKRSRSKQLQPEEYTTGTFT
LSNLGMFGVDRFDAILPTGTGAILAVAASRPTVVAGKDGSIAVKRQMQVNLTADHRVIYG
ADGAAFLKDLAELIETRPESLAL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccacagacatcttcatgcctgccctcagttccaccatgacggaggggaagatc
gtggagtggttgaagcagcctggcgacaaggtcgcccggggggagtcggttcttgtcgtt
gagtccgacaaagccgacatggacgtcgagtcgttccaggatggctacctcgctgccgtc
ttgatgcctgcgggtagcacggcaccggtgggcgaaaccatcggtctgattgttgagacc
gaagctgagatcgccgacgctcaggccaaggcccccagcgcacctgctgcagcttcggcg
cccgccccggctccggcaccggctcccacgccagctgcggtccaggccccagcgccgacc
cccgccccggctccggctcctgtcgcccccccagcgccatcggcaccggtggtgaacgat
ggccgcatcgtggcgagcccccgggccaaaaagctggcctcccagatgggagtggacctg
gccacggtgcgcggcagcggcccccatggccggattcaggcggaagacgttgagcaggcc
accgggcagccgatctccgtgccccgcgttgcggaaggaacagctcccgcagctgccgcc
ggtggcgcagcggctgcagtggccccggcagctccggcgggcaacagcttcggccggccc
ggagagaccgtggccttcaccaccctgcagggtgctgtgaataaaaacatggaggcgagc
ctggcggttccctgtttccgtgtcggttacaccatcaccaccgacaagctggatgccttc
tacaaacaggtgaagcccaagggcgtcacgatgacggcgctgctggccaaggctgtggcc
gtcaccctggcgcgccacccgcaggtgaatgccgccaccaccgccgctggtatggcctac
cccgccgacgtcaacgttgctgttgccgttgccatgggagacggtggcttgatcacaccg
gtgctgcgcaatgccgatcgcaccgatctctacgagatgtcgcgtcagtggggggatctg
gtcaagcgctcccgcagcaagcagctgcagcctgaggaatacaccacgggcaccttcacc
ctctccaacctcggcatgttcggtgttgatcgcttcgacgcgattcttcccaccggcacc
ggtgccattctcgccgtcgccgcatcacgccccacggtggtggcgggcaaagacggctcc
atcgccgtcaagcgtcagatgcaggtgaacctcacggcggaccaccgggtgatctacggc
gccgatggtgccgcgttcctgaaggatctcgctgagctgatcgagacccgcccggaaagc
ctggcgctctga

DBGET integrated database retrieval system