KEGG   Synechococcus sp. KORDI-52: KR52_12700Help
Entry
KR52_12700        CDS       T03346                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
synd  Synechococcus sp. KORDI-52
Pathway
synd00473  D-Alanine metabolism
synd00550  Peptidoglycan biosynthesis
synd01100  Metabolic pathways
synd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:synd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    KR52_12700
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KR52_12700
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    KR52_12700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:synd01011]
    KR52_12700
Enzymes [BR:synd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     KR52_12700
Peptidoglycan biosynthesis and degradation proteins [BR:synd01011]
 Precursor biosynthesis
  Amino acid ligase
   KR52_12700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_3 ATP-grasp_4 DUF2625
Motif
Other DBs
NCBI-ProteinID: AII49987
UniProt: A0A076HN28
LinkDB All DBs
Position
2250613..2251665
Genome map
AA seq 350 aa AA seqDB search
MPSSPITVGLVFGGRSGEHEVSIRSAATVVRGLRSGNNTERYTVQPIYIDRDGRWWGKDL
AEETLATETAPNLSPPLPPSGFQGFPEGSEAVDIWYPVLHGPNGEDGTIQGLFQLTGKPF
VGAGVLGSAVSMDKQAMKSAFASAGLSQVPYVALHASELEDANSRSTLLDRIESELTYPC
FVKPANLGSSVGISKVRSRTELEAGLNQAAALDPRLVVEQGVNAREVECAVLGGRRLEAS
VVGEVRFDADWYDYETKYTAGRSSTLIPAPLPDPVTERIRTQALQACAAVGVDGMGRVDF
FYDDANDQLWINEINTLPGFTAQSMFPMLWAASGVTLEQLVHQLLQSAGE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccagccctatcacggtcggcctcgtctttggaggccgctctggagagcacgag
gtatcgatccgatccgcggccaccgtggttcgcggcctgcgcagcggaaacaacacggag
cgctacaccgtccagccgatctacatcgaccgagatggccgctggtggggtaaggatctg
gccgaggagaccctggccaccgaaacggcaccgaacctcagcccgccgctgcctccctcg
ggtttccaaggcttcccggagggcagcgaagcagtcgacatctggtacccggtgctgcat
ggtcccaatggggaagatggaaccattcaggggttgttccagctgaccggcaaaccgttt
gtgggagccggggttcttggctcagcggtgagcatggacaagcaggcgatgaagtccgcc
ttcgcgagcgccgggctgtcccaggtgccctatgtggcccttcatgcctccgaactcgag
gatgccaacagccgatccaccctcctcgatcggattgaaagcgaactgacttacccctgt
ttcgtgaagcccgcgaatctcggctcctcggtggggatcagcaaggtgcggtctcgcacg
gaactggaagccggtctcaaccaggcagcagcactcgacccgagactggtggtggagcag
ggcgtcaacgccagggaagtggaatgcgcggtgctgggggggcgccgcctcgaagcatcc
gtagtcggcgaagtgcgtttcgatgcggactggtacgactacgagacgaagtacaccgct
gggcggagctccacgctgattcccgcccccctgccggatccagtgactgagcgcatccgt
acccaggcgttacaagcctgtgcagccgttggcgtcgacggcatgggtcgggtggacttc
ttctacgacgacgccaatgatcagctgtggatcaacgaaatcaacaccctgcctggtttc
acggcgcagagcatgttcccgatgctctgggcggccagtggcgtaacactcgagcagttg
gtgcaccaactgctccaatcagcaggagaatga

DBGET integrated database retrieval system