KEGG   Synechococcus sp. KORDI-52: KR52_14430Help
Entry
KR52_14430        CDS       T03346                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
synd  Synechococcus sp. KORDI-52
Pathway
synd00564  Glycerophospholipid metabolism
synd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:synd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    KR52_14430
Enzymes [BR:synd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     KR52_14430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 FAD_binding_2 Pyr_redox_2 HI0933_like Thi4 Pyr_redox GIDA Lycopene_cycl Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AII50314
UniProt: A0A076HS04
LinkDB All DBs
Position
2554814..2556391
Genome map
AA seq 525 aa AA seqDB search
MADHQMDLLVIGAGASGASVAYEATRRGLSVALLEAGDIGGGTSCRSTKLLHGGVRYLEL
AFKTLDLAQLRLVREALLERSHWLAQAPFLAQRLELALPTQQLWEQAYYRLGLGMYDALA
GQRSIGHSRLLSKRQMRQALPLLKVCQGGVAYSDGQFDDARLNLLLALTAEQQGATLRTR
CRVVELDTDGTGQLKAAISESATGQRERWCASAFVNATGIRADEIRQMAEADAPPRMLTS
RGAHIVLEQNLCPEGLGLLVPSTADGRVLFMLPFHGRTLVGTTDEPCTKENATSPSPEEE
AYLLNYVRGWFPQLKHPKVSSRWAGGRPLLKPADQDMDSSRVVREHEVETLACGLVSVMG
GKWTTCRPMAADTLDAVERQLGRALPTPEPMPLRGAAESLQATLDGLQRQKHQLEALLPD
TALRTAQVAHLQSTYGLDGLALIERAEPSRREPISPVIPLCGAELDHAIQREHARSSSDV
LARRCRLAMVDLDDAERLRPQVEALLDQAGVAAGSTSPINHQLNP
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggctgatcaccagatggacctgctggtcatcggcgccggtgccagcggtgccagcgtg
gcctatgaggcaacacgacggggactgagcgtggccctgctcgaggccggagacatcggc
ggtggcaccagttgccgcagcacgaagctgctccatggcggggtgcgctacctggagctg
gcctttaaaactctggaccttgcccagctgaggctggtgcgggaagccctgctcgaaagg
agccactggttggcccaggcgccgttcctagcccaacgactcgagctggccctgcccaca
caacagctctgggaacaggcctattaccgactggggctggggatgtatgacgccctggcc
ggtcagcgaagcatcggccacagccgactgctgtccaagcggcagatgcgtcaggccctg
cctcttctgaaggtgtgtcagggcggcgtggcctacagcgacgggcaatttgacgatgca
cgcctcaacctgctgttggccctcaccgccgagcaacagggggcaaccctgcgcacccgt
tgccgggtggtggagctggacaccgacggcacgggccaactcaaggccgccatcagtgaa
tccgccacgggccaacgggaacgctggtgcgcctcggcgtttgtgaatgccacgggcatc
cgggcggatgagatccgccagatggcggaggctgatgcccctcctcggatgctcaccagc
cgtggggcgcacatcgtgctggagcagaacctctgcccggagggccttgggcttctggtg
ccgtccaccgcggatggacgcgtgctgttcatgctccccttccacggccgcaccctggtg
gggaccacggatgaaccctgcaccaaggagaacgccacatccccctctcccgaggaggag
gcctacctgctcaactacgtacggggctggtttccccagctcaagcaccccaaggtgagc
agccgatgggcgggggggcgcccactgctgaagcccgcagaccaggacatggacagcagc
cgtgtggtgcgggagcacgaggtggaaaccctggcctgcggtctggtgagcgtgatgggg
ggcaagtggaccacctgccggccgatggccgcagacaccctggacgcggtggaacgccag
ctcggccgggcgctgcctacccctgaaccgatgccactgcgcggggcagcggagtcgttg
caggcaaccctggacggccttcaacgccagaaacaccaactcgaggccctgctccccgat
accgctctacggaccgcgcaggtcgcccatctccaaagcacctatggattggacggcttg
gccttgatcgaacgtgccgagcccagccgacgcgagcccatcagcccagtgattcccctc
tgcggcgcagagctggaccacgccattcaacgggaacatgcgcgcagcagcagcgatgtg
ctggcccgccgctgccgtctggccatggtggacctggacgatgccgaacggctcaggccc
caggtggaagccctgctggatcaagccggcgtagcggcaggctccacttcaccgatcaac
caccagttgaatccgtag

DBGET integrated database retrieval system