KEGG   Synechococcus sp. PCC 6312: Syn6312_0460Help
Entry
Syn6312_0460      CDS       T02370                                 

Definition
(GenBank) aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
syne00260  Glycine, serine and threonine metabolism
syne00630  Glyoxylate and dicarboxylate metabolism
syne00670  One carbon pool by folate
syne01100  Metabolic pathways
syne01110  Biosynthesis of secondary metabolites
syne01130  Biosynthesis of antibiotics
syne01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Syn6312_0460
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Syn6312_0460
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Syn6312_0460
Enzymes [BR:syne01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     Syn6312_0460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD
Motif
Other DBs
NCBI-ProteinID: AFY59688
UniProt: K9RQD5
LinkDB All DBs
Position
complement(464773..465900)
Genome map
AA seq 375 aa AA seqDB search
MTHSTSPTLLRTPLFDLHKKSQARIVEFSGWEMPVQYQGIVAEHQAVRQGVGMFDISHMG
KFDLKGENPLTALQPLVPTDLSQLQPGQAKYTVFLNHQGGIVDDLIVYCHSRYLVSLIVN
AATTAKDWAWLQAHLNTTELALENQTDTLVLIALQGPKAVQALQPLVDIPLDGLKNYHHQ
PATIHLPPDSPFPQVPGWIARTGYTGEDGFEIMVPKTVGQDLWQALQKSGVTPCGLGARD
TLRLEAAMALYGQDIDQTTTPLEAGLGWLVNWEKGDFIGRSALEQQKETGVSRQLVGFLM
EERQIPRPHYLIVVEGQTVGSVTSGSLPPTIAQPLGLGYVRTGLANIGQDIGVEIRGKVH
SAKIVPRPFYRRPKS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacccattcaacctctccaaccttgttgcgcacgcccttgtttgacctccacaagaaa
tcccaggcccggattgtggaattttcaggatgggaaatgcccgtgcagtatcaaggaatt
gtggccgaacaccaggccgtgcgtcagggggtggggatgtttgatatttcccacatgggt
aaatttgatctcaaaggcgaaaatcccctaacagcccttcaacccctcgtccccactgat
ttaagccagcttcaacccggccaggccaagtacaccgttttcctcaaccatcagggggga
attgttgacgatttgattgtctattgtcacagtcgttacttggtttccttaatcgtcaat
gccgccacaaccgctaaagactgggcctggctacaagcacacttgaatacaaccgaactg
gctttagaaaatcagacggacaccctcgtcctaattgccctccaaggcccaaaagcagtc
caagccttacaaccccttgttgatattcccctagacggtcttaaaaactatcaccaccag
cccgcgacgatccatttacccccagattccccctttccccaagttcccggttggattgcg
cggacgggttataccggcgaagatggatttgagatcatggtgccaaagactgtgggccaa
gacctctggcaagccttgcaaaagtctggagtgaccccctgtggcctgggagcaagggat
acactgcgtctagaggctgctatggccttgtacggacaggatattgaccaaacgacaacc
cccttagaagcgggcctgggctggctagttaattgggaaaaaggggattttattggtcgc
tctgccctagaacaacaaaaagaaactggagtctctcggcaattggttggttttctcatg
gaggagcgacaaattcctcggccccattatttgatcgttgtggagggtcagaccgtgggc
agtgtcaccagtgggagtttaccgccaacgattgctcaacccctgggcctgggctatgtc
cgtactggcctggccaacatcgggcaagacattggggttgaaatccgcgggaaagtccat
tcagccaaaattgtcccccgtccgttttatcgccgcccaaaatcctga

DBGET integrated database retrieval system