KEGG   Synechococcus sp. PCC 6312: Syn6312_2351Help
Entry
Syn6312_2351      CDS       T02370                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
syne00010  Glycolysis / Gluconeogenesis
syne00020  Citrate cycle (TCA cycle)
syne00620  Pyruvate metabolism
syne01100  Metabolic pathways
syne01110  Biosynthesis of secondary metabolites
syne01120  Microbial metabolism in diverse environments
syne01130  Biosynthesis of antibiotics
syne01200  Carbon metabolism
Module
syne_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syn6312_2351
   00020 Citrate cycle (TCA cycle)
    Syn6312_2351
   00620 Pyruvate metabolism
    Syn6312_2351
Enzymes [BR:syne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Syn6312_2351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AFY61461
UniProt: K9RV98
LinkDB All DBs
Position
2308202..2309494
Genome map
AA seq 430 aa AA seqDB search
MIREVFMPALSSTMTEGKIVAWVKEPGDKVEKGETVVIVESDKADMDVESFYEGFLAVIT
VPAGSSAPVGATIGLVAETEAEIAQAQAQAPSSPATSPPTPSSNGNSQSSNGSSVAPPII
TISTPVASGRLVASPRAKKLAKDLKVDLKTLEGKGSGPHGRITMADVEAAVGKVVTPTIP
QVPQAPVTLPTPANITPTPTVSPAALAGEVQPLTTLQNAVVRNMNASLQIPDFHVSYTIT
TDGLDALYKQIKSKGVTMTALLAKAVALTLQKHPIINACYTEQGIQYKPNINIAIAVAMP
GGGLITPVLKDADKVDIYTLSRTWKDLVERARAKQLQPDEYNSGTFSLSNLGMFGVNGFD
AILTPGQGAIMAVGGSKPTVVATKEGLIGVQSQMEVNITCDHRVIYGADAAAFLQDLAKL
IATNPQALTL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcgaagtgtttatgccggccctaagttcaaccatgactgaagggaaaattgtt
gcttgggtcaaagagcctggggataaggtggaaaagggcgaaacagttgtcattgttgag
tcagataaggccgatatggatgtggaatccttctatgaggggttcttagccgtcattacg
gttcccgccggatcttccgcccctgtgggtgccaccattggcctagttgcggaaaccgaa
gccgaaattgcccaagcccaggcccaagcccccagttcacccgccacctcgcccccaacc
ccaagcagtaatggaaatagtcaaagcagcaatggtagttcagtcgctcccccgatcatc
acgatttcaactcccgtggccagtggtcgtttagtggcctcgccccgggctaaaaagcta
gctaaagacctgaaggttgacctaaaaaccctcgaaggcaaagggagcggcccccatggt
cggattacgatggctgatgtggaagctgcggtagggaaagttgtcacaccgaccatccct
caagtcccccaggccccggttactctccccactcctgcaaatattactccaaccccaacc
gtcagccccgctgccttagccggagaagttcaacccctgacgactctccaaaatgcggtt
gtgcggaatatgaacgccagcttgcaaattcctgacttccacgttagctacaccatcacc
accgatggcctggatgccctctacaagcagatcaagtccaaaggtgtgacgatgacggct
ctcttggccaaggcagttgcgctcactctccaaaaacacccaattatcaacgcctgctac
acagaacaaggcatccaatacaagcccaacatcaatattgccattgcagtggccatgccc
ggcggtggtttgattacccctgtgttgaaagatgcggacaaagtagatatttatactctc
tctcggacttggaaggatttagtcgagcgggcccgggccaagcaactgcaaccagatgaa
tataacagcggcacctttagcctctctaatttgggtatgttcggtgtaaacgggtttgat
gcaattctcacccccggtcaaggggcaattatggcggtgggcggctcaaaacccacggtc
gtggccacaaaagaggggttaattggagtgcaatcccagatggaagtgaatattacctgt
gatcatcgagtcatctatggggctgatgccgctgcttttctccaagacctggccaaactc
attgccaccaatccccaggccttgacgttatag

DBGET integrated database retrieval system