KEGG   Synechococcus sp. PCC 6312: Syn6312_3213Help
Entry
Syn6312_3213      CDS       T02370                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
syne00473  D-Alanine metabolism
syne01100  Metabolic pathways
syne01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:syne00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Syn6312_3213
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Syn6312_3213
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:syne01011]
    Syn6312_3213
Enzymes [BR:syne01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Syn6312_3213
Peptidoglycan biosynthesis and degradation proteins [BR:syne01011]
 Precursor biosynthesis
  Racemase
   Syn6312_3213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AFY62259
UniProt: K9RYA6
LinkDB All DBs
Position
3135516..3136667
Genome map
AA seq 383 aa AA seqDB search
MLSQERLSVAQECQRAWVEVDLTALAHNARRIKRLLQAPTELMAVVKADAYGHGASLVTP
TLLDNGVDWLGVATVPEGIELRKQGIQVPILVLGAVNTPALVRAIAQWQLQPTLSSPKQA
LIFSRHLDDAPHPLPVHLMLDTGMARLGCPWEQGLEFIQFVRGLPNLQVASIYSHFAGAD
ALDPTLMQVQHHQFQSVIHQAQVNGIPIPRLHLANSAATLRDQTVHYDLVRVGLALYGLY
PAPHLAHQLKLRPVLQVRARITLIKSLAAGAGVSYGHQFIAPQPMRIAVVAIGYADGVPR
RLSNQMTVIVRGQRVQQIGAITMDQLMIDISNLPDVQEGEVVTLLGEDGHEEITVDSWAD
TLGTISWEILCGFKHRLPRIPVD
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgttgagccaagaacgattatctgttgcccaagaatgccaacgggcctgggttgaggtt
gatttaacggcccttgcccataatgcccgccgaattaagcggttattgcaagccccaact
gagttaatggcggttgttaaagccgatgcctatggtcatggtgcgagtttagtcaccccc
accttattagacaatggggtggattggttaggagtggccactgtgcccgagggaattgaa
ttacgcaaacagggtattcaagtccctattttggttcttggagcggttaataccccagcc
ctagttcgagctattgcccaatggcaattacagcccactttgtcctctcctaagcaagct
ctgatcttttcccgacatttggatgatgccccccatcccttgccagtccatttaatgttg
gatactgggatggcccgtttgggttgcccctgggagcagggcctggagtttattcaattt
gtccggggtttaccgaatctccaagttgccagtatttactcccactttgccggtgccgat
gccctagaccccacgttgatgcaagttcagcatcaccaatttcagagcgtcattcaccag
gcccaggttaatggtattcctattccccgcctccacttggccaactccgccgccaccttg
cgggatcagaccgttcattacgatttagtccgagttggcctggccttgtatggactttat
ccagccccgcatctggcccatcagcttaaactacgacccgtcttacaagtccgggcccgc
attaccttgattaaatctctagccgccggagccggagtcagttacggccatcaatttatt
gctccccagcccatgcggatcgcagtcgtagccattggttatgccgatggagtcccacgc
cgcctgtcgaatcaaatgaccgtgattgttcgtggacaacgagtgcagcagattggggcg
attacgatggatcagttaatgatcgatatttccaacttgccggatgttcaagagggagaa
gttgtgactctgttaggtgaggatggtcacgaagaaattactgtggatagctgggctgat
accctggggacaatttcctgggaaattctttgcgggtttaaacatcgtctaccgcgtatc
ccggttgattag

DBGET integrated database retrieval system