KEGG   Synechococcus sp. KORDI-100: KR100_11240Help
Entry
KR100_11240       CDS       T03344                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
synk  Synechococcus sp. KORDI-100
Pathway
synk00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:synk00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    KR100_11240
Enzymes [BR:synk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     KR100_11240
Transporters [BR:synk02000]
 Other Transporters
  Pores ion channels [TC:1]
   KR100_11240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_N_4 GST_C_5 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AII43931
UniProt: A0A076H3J8
LinkDB All DBs
Position
1993291..1994523
Genome map
AA seq 410 aa AA seqDB search
MPPSSETVEPLTWPELERLTVPETDRINGATNAQSHLRLFGHPEAAVRVTLYRDHHAWCP
YCQKVWLWLECKRIPYRIRKVTMRCYGRKEPWFLEKVPSGMLPALELDGDLITESDVILL
RLERAFGALGLPLESDRAMHLRQLERLLFRAWCLWLCSPGLTKRQQDQARDQFQAVARRL
EQEMNHLPGPWLDPDGPGSVDLVFVPYVERMNASLAYYKGFRLRQEHPAIGSWFVALEQL
ETYRGTQSDMHTHAHDLPPQMGGCWSDDNPEAAALASRIDRGEGLGQDEGEWPDASNQGM
AARALSRVLRHRKALLASNLLGAARFDQPLRCALTHLMSKQDCHPRAGSAAALRYLRDRV
SVPRDMPLPAARLLRQALEATAALDGSEHPRPLPLHDRLDQNPEAFRTAS
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgcccccttcatcggaaaccgttgaaccgctgacatggcctgaactggagcgtttgacc
gttcccgagacggatcggatcaacggagcgacgaacgcccagtcgcatctgcgacttttt
ggacatcccgaagccgctgtacgagtgaccctctacagggaccatcacgcctggtgtccc
tactgccagaaggtctggttatggctggagtgcaagcgaattccgtaccgcattcgcaag
gtgacaatgcgctgctacgggcgaaaggaaccctggtttctcgagaaagtgccctcagga
atgctgccggcccttgaacttgatggggacctgatcaccgaaagcgatgtgatccttctc
aggctggaacgggccttcggtgctctgggcctgccccttgaatcagatcgggcgatgcat
ctaaggcaacttgaacgtctgctgtttcgtgcctggtgcctctggctctgttctcctgga
ctgaccaaacgtcagcaggatcaggcccgtgatcagttccaggcagtcgcaagacggctg
gaacaggagatgaaccacctaccgggtccatggctggatcctgatggcccgggttccgtg
gacctcgtcttcgttccctatgtggaacggatgaatgcctccttggcttattacaagggc
tttcgcctgaggcaggagcatccggccatcggcagctggttcgtcgcccttgagcagctg
gagacctatcgcggcacccagagcgacatgcacacccatgcccacgacctgcctccccag
atgggagggtgctggtccgatgacaaccccgaagcggcggcgctcgccagccgcatcgat
cgcggagaaggcctcggccaggacgaaggggaatggcctgatgcctcgaaccaggggatg
gcggcccgagcgctcagcagggttctgcgtcaccgcaaggccttgctggcaagcaacctg
cttggtgccgcgcggttcgaccagcccctgcgctgcgccctgacccatctgatgagcaag
caggattgccatcccagagccggcagtgctgctgctcttcgctatctgcgcgatcgcgtt
tcggttcctcgcgacatgccactgcccgcggccaggcttctgcgtcaggctctcgaggca
acagcggctctggatggttccgaacatcctcgaccactgccgcttcacgatcggctggac
cagaacccggaagcgtttcgaacggcaagctga

DBGET integrated database retrieval system