KEGG   Synechococcus sp. KORDI-100: KR100_11815Help
Entry
KR100_11815       CDS       T03344                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
synk  Synechococcus sp. KORDI-100
Pathway
synk00473  D-Alanine metabolism
synk00550  Peptidoglycan biosynthesis
synk01100  Metabolic pathways
synk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:synk00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    KR100_11815
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KR100_11815
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    KR100_11815
Enzymes [BR:synk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     KR100_11815
Peptidoglycan biosynthesis and degradation proteins [BR:synk01011]
 Precursor biosynthesis
  Amino acid ligase
   KR100_11815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AII44037
UniProt: A0A076H532
LinkDB All DBs
Position
2087746..2088810
Genome map
AA seq 354 aa AA seqDB search
MPKTSTPVQIGLVFGGDSGEHAVSIRSAITVHQGLRRGDNRHRYEVVPVYIDRQGRWWGP
AVADAVLASGQPADEHDLPQPLPPSGFRSLPRETDAVDVWYPVLHGPNGEDGTVQGLFRL
MQRPFVGAAVLGSAVGMDKQAMKAAFAAADLPQVPYVCLQANELMSDPSREQLFKRIETL
GYPCFVKPANLGSSVGISKVRNRQELEIGLQQAAELDPRLVVEQGVSARELECAVLGRDQ
LKASVVGEILFDADWYDYDTKYTSGRSTTLIPAPLPDDVSQRVREQALLACEAVGVHGMA
RVDFFFSAETNELWINEINTLPGFTDQSMYPMLWENSGLTLEQLVHELVQTAGQ
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgccgaagacctccacacctgtccagatcggtctggtcttcggaggtgattccggcgaa
cacgccgtctcgatccggtcggccatcacagttcatcaaggtctgagacgtggagacaat
cgccatcggtatgaggtggtgcccgtctacatcgaccggcaggggcggtggtggggccct
gctgtcgccgatgcggtcctggcatccggccagccggctgatgaacatgacctgccgcag
cctttgccaccatcaggttttcgctccctgcccagggaaaccgacgccgtggacgtctgg
tatccggtgctgcatggcccgaatggtgaagacggcacggtccaggggctgttcaggctg
atgcagcgtcccttcgttggcgccgctgtgctgggttccgccgtcggcatggacaagcag
gcgatgaaagcagcctttgccgctgctgatcttccccaggttccctatgtctgtctgcag
gcgaacgagttgatgagtgatccatcccgggaacaactcttcaaacgcatcgaaaccctc
ggctacccctgcttcgtgaagcctgccaacctgggctcatccgtgggcatcagcaaggtt
cgcaaccgacaggagctcgagatcggcctgcagcaggccgcggaactcgatccacgtctg
gtggttgaacagggtgtgtcagcccgggagctcgaatgcgccgtgctggggcgggatcag
ctgaaagcgtccgtggttggggagatcctctttgacgcggactggtacgactacgacacc
aaatacacctcgggacgcagcacgaccctgattccagcgccgcttcccgacgatgtgagc
caacgcgtgcgtgagcaggctcttctcgcctgtgaggcggttggtgtgcatggcatggca
cgtgttgatttcttcttcagcgcagagaccaacgagctttggatcaacgagatcaacacc
ctccccggtttcacagatcagagcatgtaccccatgctctgggaaaacagcggcttaaca
ctcgaacagctcgtgcacgaactggtgcaaaccgctggacaatga

DBGET integrated database retrieval system