KEGG   Synechococcus sp. KORDI-100: KR100_12475Help
Entry
KR100_12475       CDS       T03344                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
synk  Synechococcus sp. KORDI-100
Pathway
synk00010  Glycolysis / Gluconeogenesis
synk00020  Citrate cycle (TCA cycle)
synk00620  Pyruvate metabolism
synk01100  Metabolic pathways
synk01110  Biosynthesis of secondary metabolites
synk01120  Microbial metabolism in diverse environments
synk01130  Biosynthesis of antibiotics
synk01200  Carbon metabolism
Module
synk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:synk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KR100_12475
   00020 Citrate cycle (TCA cycle)
    KR100_12475
   00620 Pyruvate metabolism
    KR100_12475
Enzymes [BR:synk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     KR100_12475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AII44165
UniProt: A0A076H340
LinkDB All DBs
Position
complement(2199397..2200737)
Genome map
AA seq 446 aa AA seqDB search
MATFDIFMPALSSTMTEGKIVEWLKQPGDKVGRGESVLVVESDKADMDVESFQDGFLAAV
LMPAGSTAPVGETIGLIVETEAEIAEAKAKAPTSSAPVSAAVEAQPAPAAPAAPAPVVAA
PAATPAPAPAPPAPAPAAPVVNDGRIVASPRARKLASQMGVDLATVRGSGPHGRIQADDV
ERASGQPISVPRVAEGSAPAANGQGAAAPAAAAAPAGNSFGRPGETVAFNTLQGAVNRNM
EASLAVPCFRVGYTITTDKLDRFYKQVKPKGVTMTALLAKAVAVTLARHPQVNAATTPAG
MAYPAEVNVAVAVAMEDGGLITPVLRQADRTDLYEMSRQWKDLVKRSRSKQLQPEEYSTG
TFTLSNLGMFGVDRFDAILPPGTGAILAVAASRSTVVAGADGSIAVKRQMQVNLTADHRV
IYGADGAAFLKDLAELIELRPESLAL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
ttggcgaccttcgacatcttcatgccagccctcagctcgacgatgacggagggaaagatc
gtcgagtggctgaagcaaccgggcgacaaggtcggacgtggtgaatcggtgttggttgtt
gagtccgataaggctgatatggacgtggagtcgttccaggatggttttctggccgctgtc
ctcatgcctgcgggcagcacggcgcctgtcggcgaaaccatcggcctgattgttgaaaca
gaagcggagatcgctgaggccaaggccaaagcaccgacctcctccgcaccggtttccgcc
gcagttgaggcacagccagcgccagctgctccggcagctccggctcctgtggtggcagca
ccggcagccactccggcacccgcgcctgccccaccggcaccagccccggcggctcctgtg
gtgaacgacggccgcatcgtggccagcccccgcgccaggaagctcgcctcccagatgggt
gtggatctggccaccgttcgcggcagcggaccccatggccgcattcaggcggacgacgtg
gagcgggccagcggtcagccgatctccgtgcctcgggtggcagagggttcagcaccggca
gccaacggccagggcgcagcagcgcctgcggccgcggctgcaccggctggcaacagcttt
gggcgtccgggcgagaccgttgcgttcaacaccctccagggagcggtgaaccggaacatg
gaagccagtctggcggtgccctgtttcagggtcggatacacgatcaccaccgacaagctc
gatcgcttttacaaacaggtgaagccgaagggcgtcacgatgacggctctgctggccaag
gcagtggccgtcactctggcccgtcatccccaggtgaacgccgccacaacgccagctggg
atggcctaccccgcagaggtgaatgtggcggttgctgtcgctatggaggatggcggtctg
attacaccggtgctgcgtcaagccgatcgcacggatctctatgagatgtcacgccagtgg
aaggatctggtcaagcgatcccgcagcaaacagctgcagccagaggaatacagcacaggc
accttcaccctctccaacctcggcatgttcggggttgatcgctttgatgcgattcttccg
ccaggcacgggagccattcttgccgttgcggcttcacgttccaccgttgtggcaggagcg
gatggatcgattgccgtgaagcgacagatgcaggtcaatctcaccgcagaccatcgagtg
atttatggcgctgatggcgcagccttcctcaaggatctggccgagctcatagaactccga
ccagagagtctggctctctga

DBGET integrated database retrieval system