KEGG   Synechococcus sp. KORDI-100: KR100_12475
Entry
KR100_12475       CDS       T03344                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
synk  Synechococcus sp. KORDI-100
Pathway
synk00010  Glycolysis / Gluconeogenesis
synk00020  Citrate cycle (TCA cycle)
synk00620  Pyruvate metabolism
synk01100  Metabolic pathways
synk01110  Biosynthesis of secondary metabolites
synk01120  Microbial metabolism in diverse environments
synk01200  Carbon metabolism
Module
synk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:synk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KR100_12475
   00020 Citrate cycle (TCA cycle)
    KR100_12475
   00620 Pyruvate metabolism
    KR100_12475
Enzymes [BR:synk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     KR100_12475
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Other DBs
NCBI-ProteinID: AII44165
UniProt: A0A076H340
LinkDB
Position
complement(2199397..2200737)
AA seq 446 aa
MATFDIFMPALSSTMTEGKIVEWLKQPGDKVGRGESVLVVESDKADMDVESFQDGFLAAV
LMPAGSTAPVGETIGLIVETEAEIAEAKAKAPTSSAPVSAAVEAQPAPAAPAAPAPVVAA
PAATPAPAPAPPAPAPAAPVVNDGRIVASPRARKLASQMGVDLATVRGSGPHGRIQADDV
ERASGQPISVPRVAEGSAPAANGQGAAAPAAAAAPAGNSFGRPGETVAFNTLQGAVNRNM
EASLAVPCFRVGYTITTDKLDRFYKQVKPKGVTMTALLAKAVAVTLARHPQVNAATTPAG
MAYPAEVNVAVAVAMEDGGLITPVLRQADRTDLYEMSRQWKDLVKRSRSKQLQPEEYSTG
TFTLSNLGMFGVDRFDAILPPGTGAILAVAASRSTVVAGADGSIAVKRQMQVNLTADHRV
IYGADGAAFLKDLAELIELRPESLAL
NT seq 1341 nt   +upstreamnt  +downstreamnt
ttggcgaccttcgacatcttcatgccagccctcagctcgacgatgacggagggaaagatc
gtcgagtggctgaagcaaccgggcgacaaggtcggacgtggtgaatcggtgttggttgtt
gagtccgataaggctgatatggacgtggagtcgttccaggatggttttctggccgctgtc
ctcatgcctgcgggcagcacggcgcctgtcggcgaaaccatcggcctgattgttgaaaca
gaagcggagatcgctgaggccaaggccaaagcaccgacctcctccgcaccggtttccgcc
gcagttgaggcacagccagcgccagctgctccggcagctccggctcctgtggtggcagca
ccggcagccactccggcacccgcgcctgccccaccggcaccagccccggcggctcctgtg
gtgaacgacggccgcatcgtggccagcccccgcgccaggaagctcgcctcccagatgggt
gtggatctggccaccgttcgcggcagcggaccccatggccgcattcaggcggacgacgtg
gagcgggccagcggtcagccgatctccgtgcctcgggtggcagagggttcagcaccggca
gccaacggccagggcgcagcagcgcctgcggccgcggctgcaccggctggcaacagcttt
gggcgtccgggcgagaccgttgcgttcaacaccctccagggagcggtgaaccggaacatg
gaagccagtctggcggtgccctgtttcagggtcggatacacgatcaccaccgacaagctc
gatcgcttttacaaacaggtgaagccgaagggcgtcacgatgacggctctgctggccaag
gcagtggccgtcactctggcccgtcatccccaggtgaacgccgccacaacgccagctggg
atggcctaccccgcagaggtgaatgtggcggttgctgtcgctatggaggatggcggtctg
attacaccggtgctgcgtcaagccgatcgcacggatctctatgagatgtcacgccagtgg
aaggatctggtcaagcgatcccgcagcaaacagctgcagccagaggaatacagcacaggc
accttcaccctctccaacctcggcatgttcggggttgatcgctttgatgcgattcttccg
ccaggcacgggagccattcttgccgttgcggcttcacgttccaccgttgtggcaggagcg
gatggatcgattgccgtgaagcgacagatgcaggtcaatctcaccgcagaccatcgagtg
atttatggcgctgatggcgcagccttcctcaaggatctggccgagctcatagaactccga
ccagagagtctggctctctga

DBGET integrated database retrieval system