KEGG   Synechococcus sp. PCC 7502: Syn7502_00221Help
Entry
Syn7502_00221     CDS       T02371                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
synp  Synechococcus sp. PCC 7502
Brite
Enzymes [BR:synp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Syn7502_00221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFY72388
UniProt: K9SQB8
LinkDB All DBs
Position
complement(217818..218420)
Genome map
AA seq 200 aa AA seqDB search
MAFELPTLPYAKEALEPYISAQTLEFHYGKHHAGYVTNLNNLTKDTELADKSLEEVVKVT
YGDPAKVGIFNNAAQVWNHTFYWNSIKEKGGGVPTGALAAKIDEDFGSFEKFKETFKATG
VGQFGSGWAWLVLDQGTLKITKTANAENPLVHGQIPLLTIDVWEHAYYLDYQNRRPDYAQ
TFLDSLVNWDFAAQNYAAAI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaacttcctacattaccatacgcaaaagaagctctagaaccttacatatct
gcacaaaccctagaatttcactatggtaagcatcatgcaggctatgtaaccaatctcaat
aaccttactaaagacacagaattagctgacaagtccttagaggaagttgtcaaagttacc
tatggtgatccagctaaggttggtatttttaacaatgctgcccaagtctggaatcatact
ttttactggaattccattaaagaaaaaggtggtggagtacccacaggtgccttagctgca
aaaattgacgaggattttggtagttttgaaaaattcaaagaaacctttaaagcaactggc
gttggtcagtttggcagtggctgggcttggctagtgcttgatcaaggtacgttgaaaatc
actaaaactgcaaatgcggagaatccattagtccacggacaaattcctctactcaccatt
gatgtatgggaacacgcctactatttggattatcaaaatcgtcgtcctgactatgctcaa
actttcctagatagcttggttaactgggactttgcggctcaaaactatgcggcagcaatc
taa

DBGET integrated database retrieval system