KEGG   Synechococcus sp. PCC 7502: Syn7502_00546Help
Entry
Syn7502_00546     CDS       T02371                                 

Definition
(GenBank) glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
synp00970  Aminoacyl-tRNA biosynthesis
synp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:synp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Syn7502_00546
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:synp03029]
    Syn7502_00546
Enzymes [BR:synp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Syn7502_00546
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Syn7502_00546
Mitochondrial biogenesis [BR:synp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Syn7502_00546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AFY72701
UniProt: K9SRY9
LinkDB All DBs
Position
557671..559137
Genome map
AA seq 488 aa AA seqDB search
MAKTQYETIIGLETHCQLTTETKIFCGCSTRFGVSPNGNVCPVCLGMPGMLPVLNEKVLE
YAVKAGLALNCAIAPLSKFDRKQYFYPDLPKNYQISQYDLPIAEHGWLQIELEDAITKEA
KSKKIGITRLHMEEDAGKLVHGGSDRLSGSSHSLVDYNRAGVPLCEIVSEPDIRSGAEAA
AYAQELRRILRYLGVCDGNMQEGSLRCDVNISVRPVGTEKFGTKVEIKNMNSFNAIQRAI
DFEIERQVEAYESGEPVIQETRLWEENSQRTISMRTKEGASDYRYFPEPDLVAIAVPEQT
LVKYQSELPELPAAKRQKYRNLGLTAYDAQLIADDRSVAEYFEAAIALGADPKQAFNWIM
GDITSYLKEQKLKIADIPLNPTVLAELVSLITDGTISSKIAKDILPELLVNGGSVKALVK
AKNLTVLSGDALEKIIDQVIAANPKELEQYRAGKTKLLGFFVGQVMKATNGQAAPQATNQ
LLSQKLNT
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaacccaatacgaaaccattattggactcgaaacccattgccaactgacaacc
gagactaaaattttctgtggttgctccactcgatttggggtgtctcccaatggtaatgtc
tgtcctgtgtgtttgggaatgccaggaatgctccctgttttgaacgaaaaagtgttggaa
tatgcagttaaagcaggacttgccttgaattgtgcgatcgctcccctcagtaaatttgat
cgtaagcaatatttttatcccgatctgcccaagaattaccaaatctcccaatacgatctc
cccattgccgaacatggctggttgcaaattgagcttgaagatgccatcactaaagaagcc
aaaagtaaaaaaattggcattactcgtctgcacatggaagaagatgcgggtaaattagtc
cacgggggcagcgatcgcctttcgggttctagtcattctttggtggattacaatcgagcg
ggtgtcccattgtgtgaaatcgtttcggaacctgatattcgctctggggctgaagctgcg
gcatacgctcaagaattacgtcgtattttaagatatttgggtgtatgtgacggcaatatg
caagaaggttctctgcgttgtgatgtcaatatatccgtgcgtcctgtgggtacagaaaag
tttgggactaaggttgagatcaaaaatatgaactcctttaatgccattcaacgggcgatc
gactttgaaattgagcgtcaagtggaagcttacgaatcaggcgaaccagtgattcaagaa
actcgcctctgggaagagaattcccaacgcaccatcagtatgcgcacaaaggaaggtgcc
agtgattatcgctatttccctgagccagatttagtagcgatcgctgttccagagcaaacc
ttagttaaatatcaatctgaattacccgaattacccgccgccaaacggcaaaaatatcga
aatttgggtttaaccgcctacgatgctcaactgattgctgacgatcgctctgtagcagag
tattttgaagctgcgatcgccctcggtgccgatcctaaacaagcatttaattggattatg
ggggatattacttcttatctaaaagaacaaaagctcaaaattgctgatattcccctaaac
ccaacagttttagcagagttagtatctttaattaccgatggaactattagtagcaaaatt
gccaaggatattctgcctgaacttttggtaaatggcggatcggttaaagcattggtcaaa
gccaaaaatctcacagtgctatctggggatgccttagaaaaaattattgatcaagtaatt
gctgcaaatcccaaggagctagaacaatatcgggcaggtaaaactaaactattgggcttc
tttgtgggacaagtaatgaaagccaccaacgggcaggctgcacctcaagctactaatcaa
ttactcagccagaaacttaatacttag

DBGET integrated database retrieval system