KEGG   Synechococcus sp. PCC 7502: Syn7502_00601Help
Entry
Syn7502_00601     CDS       T02371                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
synp  Synechococcus sp. PCC 7502
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-ProteinID: AFY72751
UniProt: K9SS40
LinkDB All DBs
Position
603152..604999
Genome map
AA seq 615 aa AA seqDB search
MTKSSQAKYRIIGLVGRGQFGRVFCARDRLAHNQLVALKELEPRRFPTNQFLRELRFLLS
LRHPHIVSCISVDYSQNRRYLVMEYCEAGTLRNLIDGNLERSPSWQNNLPQHNLQQYLRL
VIEILAGLKYAHSLNIVHCDIKPENVLLKLTKTGWQAKISDFGIARLAQENDKPDNNGSP
GYMAPERFYGQYSHASDLYAVGVILYELLTKERPFSGNPIELMYAHLNQRVKVPDYVPDV
LKTFLYKALEKLPARRFKSADQMQEQLEPILSASLTLPIGENPICENQALISNKPDPNTL
SFAIVEKSLTEPIIALGVFAHSNLSLSFYSASQFLLTRRNLSSILNFRNSFTFTAKITDL
AITQDHEFVITSESIGMMINNFQDYQVLYTADYNANQKFYWAIANQWLGVLTATPNSGQF
QLQIQRLAKTFIKPNWKSLIISSLLKNSEIVALLAIDHNHLTAIISNSTASNIHVISRRG
NLIATYALPVGVVMAIASDQVGRILVVTELNYLLLIDWRPYRLQRVELGYRPQMIKATKW
GYITTQGETNSLLSFMDEQGNYVGEYAVTGHVEAIACISNNVLAIAVKFLTSEMNDGGGK
LLLLDLRQLNLDLVF
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaagttctcaagcaaagtatcgaattataggactagtagggcgggggcagttt
ggtcgagtattttgtgcgcgcgatcgcttagctcataaccaattagtcgctcttaaggaa
ttggaaccacgccgatttcccactaatcaatttttgcgagagttaagatttttattatct
ttacgccatccccatattgttagctgtatttctgtggattacagtcagaatcgccgttat
ttggtgatggagtattgcgaggctggcaccttaagaaatttaattgacgggaatttagag
cgatcgcctagctggcaaaacaacttaccccaacataatttacagcaatatcttaggttg
gtgatcgaaattttagcaggcttaaaatatgcccatagcttgaatattgtccactgtgat
attaaacctgaaaatgttttattgaagctgacaaaaacaggatggcaagctaagatttct
gattttggcattgcccgcttagcacaggaaaacgataagcctgataataatggctcaccc
ggctatatggcaccagaaagattttatggacagtattcccatgcttccgatctctatgct
gtgggtgtaattttgtatgaattattaactaaagaacgtccctttagcggcaaccccata
gaattaatgtatgcccatttaaatcaaagggttaaggtgccagattatgtgccagatgta
ttaaaaacttttttgtataaagccttagaaaaattacctgctcgtcgctttaaaagtgca
gaccaaatgcaagagcaattagagccaattttgtcggcatcactgactttgccaattggc
gaaaatccaatttgtgaaaatcaagccttaatatctaataaacctgatccgaacacctta
agttttgcgatcgtggaaaaaagtttgactgaacctatcattgccctaggcgtatttgca
cattctaaccttagcttaagtttttatagtgccagtcaattcctattaacaaggaggaac
ctatcatcaattttaaattttagaaattcctttacttttacggcaaaaattaccgatttg
gcaattacccaagatcatgaattcgtaattacgagcgaatccataggtatgatgattaat
aactttcaagattatcaagttttatacactgccgattacaatgctaatcaaaaattttac
tgggcgatcgctaatcaatggctgggcgtgttgactgcaactccaaattctgggcaattt
caactgcaaattcagagacttgcaaaaacatttataaaaccaaattggaagtcattaata
atatcgagtttattaaaaaattcggaaattgtcgctctcttagcaattgatcataaccat
ttaacagccatcatcagtaattctactgctagtaatattcacgttatttctcggcggggt
aatctgatagcaacctatgctttacctgtgggagttgtaatggcgatcgccagtgaccaa
gttggaagaatcttagttgtgacggaattaaattatctactgctcatagattggcgaccc
tatcgattgcaacgggtggaattaggctatcgaccacagatgatcaaagctacaaagtgg
ggctatataaccactcaaggggaaactaattctctattaagttttatggacgaacagggt
aattatgtaggggaatatgcagttacaggtcatgtagaggcgatcgcctgtattagtaat
aatgtcttagcaattgcggttaaattcttaactagtgagatgaatgatggcggtggcaag
cttttacttttagacctaaggcaactgaatttagatttagtgttctaa

DBGET integrated database retrieval system