KEGG   Synechococcus sp. PCC 7502: Syn7502_00631
Entry
Syn7502_00631     CDS       T02371                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
synp00010  Glycolysis / Gluconeogenesis
synp00020  Citrate cycle (TCA cycle)
synp00620  Pyruvate metabolism
synp01100  Metabolic pathways
synp01110  Biosynthesis of secondary metabolites
synp01120  Microbial metabolism in diverse environments
synp01200  Carbon metabolism
Module
synp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:synp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syn7502_00631
   00020 Citrate cycle (TCA cycle)
    Syn7502_00631
   00620 Pyruvate metabolism
    Syn7502_00631
Enzymes [BR:synp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Syn7502_00631
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase
Other DBs
NCBI-ProteinID: AFY72780
UniProt: K9SRK8
LinkDB
Position
complement(645860..647152)
AA seq 430 aa
MIYEIFMPALSSTMTEGKITAWVKSIGDKVEKGETVLVVESDKADMDVESFYEGYLGAIA
VPAGETAPVGSTLGYVAETVAEIADIKSKLSQTSEPVAASTNGTSTGTAIPEVVVTKVET
PAIAKSDRLIATPRAKRIAKENNLDLAKINGSGPNGRITEQDVTALLQVPVQATPAKVSV
KAPEPIAASIPSAPVSTTPKVTYTPQLGTTKPLTTLQNAVVRNMNASLSVPTFHVGYTIT
TTGLDELYKQIKSKGVTITALLAKAVAVTLQRHPIVNASFSDQGIVYKSDINVAIAVAME
DGGLITPVLPKANESDIYSLSRHWKSLVERARAKQLQPEEYNSGTFTISNLGMFGVDRFD
AILPPNTGAILAIGASHPQVVATKDGAIAVRNQMQVNLTADHRIIYGADAAKFLQDLAKL
LETDAQSLVL
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgatctacgaaattttcatgcccgctttaagttccacgatgaccgagggtaaaatcacg
gcttgggttaaatccattggcgacaaagtagaaaagggtgaaaccgtcttagttgtggaa
tctgataaggcagatatggatgtggaaagcttctatgaaggctatttaggggcgatcgcc
gtacctgcgggagaaactgcacccgtaggtagtaccctaggctatgtggcagaaacagtt
gccgaaattgctgatattaagtccaaactaagccaaacctctgagccagttgcggcttct
actaacggcactagtactggcacagctattcctgaagtagtggttactaaggttgaaacc
ccagctatagccaaaagcgatcgtctaattgccactcctagagcaaaacgcattgctaaa
gaaaataacctagacctagctaaaattaacggttctggacccaatggcagaattactgag
caagatgttactgccctgttgcaagttccagttcaagccacccctgctaaagtatcagta
aaggcacctgaaccgatcgctgcgtcaattccctctgccccagtttccaccactcccaaa
gtcacctatacgcctcaactgggaactactaaacccctcacaactctgcaaaatgctgta
gtgcgtaacatgaatgccagtttaagtgttccgacttttcatgtgggctataccatcacc
accactggtttagatgaactttacaagcagattaaatctaaaggtgtaaccataacagct
ctgttagcaaaggcggtagcagtgaccctccaaaggcatcccatagttaatgctagtttt
agtgatcagggtatcgtttataaatccgatattaatgtggcgatcgccgtagccatggaa
gatggtggtttaattacacccgtgctacctaaggcaaacgaaagtgatatttacagccta
tcccgtcactggaaatcccttgtggaaagggcaagagccaaacaactgcaaccagaagaa
tataattcgggaactttcactatttccaatttaggtatgtttggagtagatcgatttgat
gctatcttgccaccaaatacaggtgcgatcttagctatcggtgcatctcatccccaagtg
gttgctaccaaagacggagcgatcgcagtgcgcaatcaaatgcaagttaacctgactgcc
gatcaccgcattatctatggtgctgatgccgccaagtttttacaagaccttgctaaatta
ctggaaaccgatgctcaatccttagttctataa

DBGET integrated database retrieval system