KEGG   Synechococcus sp. PCC 7502: Syn7502_00670Help
Entry
Syn7502_00670     CDS       T02371                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
synp00620  Pyruvate metabolism
synp00680  Methane metabolism
synp00710  Carbon fixation in photosynthetic organisms
synp01100  Metabolic pathways
synp01120  Microbial metabolism in diverse environments
synp01200  Carbon metabolism
Module
synp_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:synp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Syn7502_00670
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Syn7502_00670
   00680 Methane metabolism
    Syn7502_00670
Enzymes [BR:synp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Syn7502_00670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFY72818
UniProt: K9SRI8
LinkDB All DBs
Position
complement(683085..685976)
Genome map
AA seq 963 aa AA seqDB search
MSSSVLELSLAQVIDQENALRVIDSRFRYRLKVMEELLESVLLDESGQELVDLLRQLRAM
CSPEGQAPAYPAQEVLKVVESLDLPQAITAARAFALYFQLINIIEQNYEQEETSQQRADH
IMGESKFPVGTFRWLFPELKRQNVPNRYIQTLLDQLDIQLVFTAHPTEIVRHTILDKQRS
IAKILKQLDGFIPDSSLSWEAQALQERLAEEIRVWWRTDELNQSQPTVLDEADYALHYFQ
EVLFDAVPILYDRLERALKQSFPHMKLPASNFCKFGSWVGSDRDGNPFVTPEITWQTACY
QRGLVLGKYISSVNKLIGSMSLSQQLTDVSQSLLDSLSQDQFYMPDVYQSCAVRFRYEPY
RFKLSYIRKRLENTYDRNLKVKSTGWEASEFVLRIPDDDRSIYRNANQFLEELYLLQSSL
TETKLNCKDLQALIRQVEVYGFHLAHLDIRQESTRHEQAIAEVAAHLQTLGEPYSELLEE
HKVAWLSHELQTRRPLIPRDLAGFSDKTIEAIATLRMVSKLQKEFSPSICHTYIISMNHS
VSDILEVMLLAKGAGLYDVAKGSGTLAIVPLFETVEDLKNAPQVLTQLFQIEIYRNYLAS
QDHLQEVMLGYSDSNKDSGFLSSNWEIYKAQQSLQLTAQKFGVELRIFHGRGGSVGRGGG
PTYEAILAQPGHQLNGRIKITEQGEVLASKYSLPELALYNLESITTGVIQAGLLPNSFGT
LTAWLELMEDLAQRSRSVYRELIYEQPDLATFFHQVTPLEEISQLRISSRPARRAGKKDL
ASLRAIPWVFGWTQSRFLLPSWYGVGTALEEFLNENPDLHLTLLQSLYSKWSFFKTVISK
VEMTLAKADLQIAHHYVRELSEPSYRETFEQMFTQINQEYMRTCKVVLQITNHERLLDGD
RDLQRSVQLRNGSIVPLGFIQASLIKRLRQHKSDMRSRYSKGELLRGALLTVNGIAAGMR
NTG
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atgagttcctcagtcctagagctttcactggctcaagttattgatcaagaaaatgcttta
cgagtaattgactctcgttttcgctaccgcctcaaggtaatggaagagcttttagaatca
gtcttgctagatgaaagtggacaggaactggttgatcttttacgccaattacgggcaatg
tgttcacccgaaggacaagctcccgcctatcccgcccaagaagtattaaaggtggtagaa
agccttgacttaccccaagcaattacggctgcccgtgcctttgctctttattttcagctt
attaacattattgaacaaaactatgaacaggaggaaactagccagcagcgtgcagatcac
attatgggtgagtcaaagtttcccgtaggtacatttcgttggctttttcctgaattaaaa
cggcagaatgtccccaatcgctatattcaaaccttacttgatcaactggatattcaactg
gtatttactgcccatcctacggagattgtgcgccatacgatcttagataaacagcgcagc
attgctaaaatcttgaagcagttagatggctttataccagatagttccctaagctgggag
gcgcaggctttacaagagcgactagcagaggaaattcgggtgtggtggcgtactgatgaa
cttaatcagtctcagcctacggttttagatgaagcggattacgccttgcattacttccaa
gaggttttatttgatgctgttcccattttgtacgatcgcctagaacgggcattaaagcaa
tcatttcctcacatgaagttacctgcttctaatttttgtaagtttgggtcatgggttggt
tccgatcgcgatggcaatccctttgtcacccctgaaatcacttggcaaactgcctgctat
caacgtggtctagttttaggaaaatatattagctccgttaataaactgattggcagtatg
tctctatcccagcaattaaccgatgtatcccagtctttgctggactcattgagtcaagat
cagttttatatgcctgatgtttatcagtcctgtgctgtcagatttcgctatgagccttat
cgatttaagttgtcctatattcgcaaacgattagagaatacctacgatcgcaatcttaaa
gttaaatctacgggctgggaagcttcggagtttgtgttaaggattcccgatgacgatcgc
agtatctaccgtaatgccaaccaatttttagaagagttatatttgctgcaatcaagtttg
actgaaaccaagttaaattgcaaagacttacaagctttgatccgtcaagtcgaagtctat
ggattccacctcgctcacttggatattcgacaagaaagtacccgccatgagcaggcgatc
gctgaagtggctgcccatttacagaccttgggagaaccctattcagagctactagaggaa
cataaagtcgcatggctatcccatgaactccaaactcgtcgtccacttatacccagagat
ttagcgggattttctgataaaaccattgaagcgatcgccacgttacggatggtatcaaaa
ctgcaaaaggaattttcccctagcatctgccatacctacattatcagcatgaatcatagt
gtaagcgatattttagaggtaatgttactagcaaaaggggcgggattatatgatgtggca
aaaggttcaggcaccctagcgatcgtgcctttatttgaaaccgtagaagaccttaaaaat
gccccgcaggtattgacgcaattattccaaatcgagatttatcgcaattaccttgctagt
caagaccatctgcaagaagtgatgctagggtactctgacagtaataaggactcaggattt
ttaagtagcaactgggaaatatacaaagcacagcaatcactgcaacttactgcccaaaaa
tttggagtagagttacggatttttcacggtcggggcggctccgtgggcaggggcggtggt
ccaacctacgaggcaattttggcacaaccggggcatcagctaaatggcaggattaaaatt
acggaacagggagaagtccttgcttctaagtattctttaccagagttggctttatacaac
ctggaaagtattaccactggcgtaattcaagcgggactgctacccaacagtttcggcact
ttaaccgcttggctagaactgatggaagacttagcacagcgatcgcgaagtgtgtatcga
gaattaatctatgagcaacctgatttagccaccttctttcatcaagtcaccccccttgaa
gagattagccaactgcgaattagctctcgtcctgcccgccgtgctgggaaaaaagattta
gctagcttaagagcaataccctgggtatttggctggactcaaagtcggtttttattgcct
tcatggtatggagtgggtacagctttggaagagttcttaaatgaaaaccctgacctgcat
ttaactctgttgcaatctttgtattctaaatggtcattttttaagacagtaatttctaag
gtggagatgaccttggcgaaagccgatctgcaaattgcccaccactatgtgcgagaacta
tcggaaccgagctatagagaaacctttgagcagatgtttacgcagattaatcaggagtat
atgcggacttgcaaggtggtattacaaattactaaccacgagcggttactagatggcgat
cgcgacctgcaaagatcggttcaacttcggaatggttccattgtgccgttaggatttatc
caagcttctttaatcaaacggctgcgtcaacataaatcagacatgcgatcgcgctattct
aaaggcgagctactacggggtgcactcttaactgtgaatgggattgcggcagggatgcga
aatacgggttag

DBGET integrated database retrieval system