KEGG   Synechococcus sp. PCC 7502: Syn7502_01644Help
Entry
Syn7502_01644     CDS       T02371                                 

Definition
(GenBank) ATPase involved in DNA repair
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
synp  Synechococcus sp. PCC 7502
Brite
KEGG Orthology (KO) [BR:synp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:synp03400]
    Syn7502_01644
DNA repair and recombination proteins [BR:synp03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Syn7502_01644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N AAA_27 SbcCD_C Rad50_zn_hook AAA_29 AAA_21 Fib_alpha ACT RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AFY73700
UniProt: K9SU64
LinkDB All DBs
Position
complement(1634857..1637883)
Genome map
AA seq 1008 aa AA seqDB search
MIPQKLSLTNFLSYQNLALDFSGLHIACICGANGAGKSSLLEAMTWALWGISRANSEDDM
IYVGAKEAKVDFVFKAQGQIYRIIRTRPKGSAGSLEFQIKNNEQFKSLTERGLRATQQVI
IAHLKMDYSTFVNSAYLRQGRADEFMLKRPSDRKAVLAEMLNLGQYDELSEKAKDITRIC
KGEITALENARQNLETQITAGAHIDSDLQTLTSELEQVQAQDAVTQQQLVVLQQTQQQRQ
NWEQRWQWQQQQTQQLNSEIARLQQQVDQQYQQIKNLENLLNHQETITNQYRHYQQLANQ
EAAYNHKLQQYQKISGDRTHIQQQLAEKKSELNGSLRHYQAQLELIMQQKQDLQNILNKA
PEIESVIAQLQQAKIKLQEVEELQIKSVPLYQRRQVLQRTIDREIAQIHAQLDQIQKQQQ
LLRSQAQPNLIHNLQGLEQQIKILEKKQVYQQRVHEKGLERRDFLNRLKERQLDCEQRIQ
EQQTKSQQLQQPDTPCPLCDRPLDQAHWQIIAQKHQVLSQELQAELWIIKEQQSASECEI
QVLRDEYRHLKEELEQLNPLLQKKGNLEAQLTSHHQAESKLQGLDQDIQALQHKLDRQNF
CTDDRNNDQNDAQTELQLIEASLSSLNYDEKNHALARGEVERWRWAEAKVNELKTSRRQW
ESLSIKIPELQALIQKLAHHLHTNTIDLELQQRLETCDRTLEQINYDPDQHQEIRTQKEQ
AQPFLLQYQELNLAQQQYPNLLAEFQKNQNLMSDRTVELQRITTEIRSLELSLQETPDPS
SQIQDLQGQIINRRSHLDHLIGEIGRLQAAQTQRQYLLNQLQQVTAQISQTQKRQLIHQE
LQQAFGKNGIQALMIEIILPQIEAEANRILSTLSNYQLNVRFITQKAGKKADKVIDTLEI
EIADSRGTRPYETYSGGEVFRINFAIRLALARITAQRMGGTLQTLIIDEGFGTQDSEGCD
RLLSAINAIASDFACILVITHMPQLKEAFSTLIEITKTESGSKINLLV
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgattccccaaaagctaagcctgacaaatttcttgagctatcaaaatctggctttggat
ttttcgggcttgcatattgcctgtatttgtggtgccaatggagcgggtaaatcttcatta
ttagaggcaatgacttgggcattatgggggatcagtcgtgccaatagcgaagatgacatg
atttatgtcggagcaaaggaggcaaaggtagattttgtctttaaggcgcagggacagatt
tatcggattattcggactcgccccaagggtagtgcaggttcactggaatttcaaattaaa
aataacgaacagtttaagtctctgaccgaacggggattgagggcaacgcagcaagtgatt
attgcccacctcaaaatggattacagtacttttgtcaactctgcctacttacgacaggga
cgggctgatgaatttatgctaaaacgtcctagcgatcgcaaggctgtactcgcagaaatg
ttaaatttagggcagtatgatgaactcagtgaaaaggcaaaggatattaccagaatttgt
aaaggtgaaatcacggcattagaaaatgcccggcaaaacctagaaacccaaattactgcg
ggcgcacacatagattctgatttgcaaactctaacttcagaattggagcaggttcaagct
caagatgctgtgactcaacaacagttagtggttcttcaacaaacacaacaacaacggcaa
aactgggagcaaagatggcaatggcagcagcaacaaactcaacaattgaactcagagatc
gcaaggttacagcaacaagtcgatcagcaatatcagcaaattaaaaatctagagaatcta
ctaaatcatcaagaaacaattacgaatcaatatcggcattatcagcaattagctaaccaa
gaagcagcctataaccacaaactccagcaatatcaaaaaattagtggagatcgcacacac
atacaacaacagttagcagaaaagaaaagcgaactcaatggcagcctacgtcattatcag
gcacagctagagttaataatgcagcaaaaacaagacctgcaaaatattttaaataaagct
ccagaaattgaatcggtgatcgcccagttgcaacaggcaaaaattaagctccaagaagtc
gaggaactgcagatcaagtctgtacccctataccaacgtcggcaagttttgcaaagaacc
attgatcgagaaattgctcaaatccatgcccaactagatcaaattcagaaacagcagcaa
ctactgcgatcgcaagctcaacccaatttaatccataatttacagggactagagcagcaa
attaaaattctggaaaaaaagcaagtttaccaacaacgagtccatgaaaaagggctggaa
agacgagatttcctcaatcggctaaaagagcgtcaactagactgtgaacaaaggattcaa
gagcaacaaactaaatcccagcaactacaacaacctgatactccctgtcccctatgcgat
cgccccttagatcaggcacattggcagataattgcccaaaaacaccaggtactatcccaa
gaattgcaggcggagctttggattattaaagaacaacaaagtgcttcagagtgtgaaatt
caagttctgagagatgagtaccgccaccttaaagaagagctagaacaattaaatccgctt
ttacaaaaaaaaggtaacctcgaggcacagttaacatcccatcaccaagctgaatctaag
ctccaaggattagaccaagacatccaagccttacaacacaaacttgatcgccaaaacttc
tgcactgacgatcgaaataatgatcaaaatgatgctcaaacggaattgcaattaatagaa
gccagcctatccagccttaactatgatgaaaaaaatcatgcccttgcccgtggggaagta
gaaagatggcgatgggcagaagccaaagtcaatgagcttaaaacctctcgccgtcagtgg
gaaagcctatctataaaaattccagaactgcaagccctcatccaaaaattagcgcaccat
ttgcacaccaataccattgatctggaattacaacaacgtcttgaaacctgcgatcgcacc
cttgaacaaattaactacgatcccgatcagcatcaagaaattagaacccagaaagaacaa
gctcagccttttttgctgcaatatcaagaattaaacttggcacaacagcagtaccctaac
ctgctcgccgaatttcagaaaaatcaaaacctgatgagcgatcgcactgtagaactgcaa
aggatcaccaccgaaattaggagcctagagcttagtcttcaggaaacccccgatccctca
agtcaaattcaagaccttcaagggcaaatcataaacaggcgatcgcatttagatcatcta
attggggaaatcggtaggctccaagccgcccaaacccagcgtcaatatctgctcaatcaa
ttgcaacaggttactgctcaaattagccaaacccaaaaacgccaactcatacaccaagaa
ctacagcaagcatttggcaaaaatgggattcaagcattaatgattgaaataattctgccc
caaattgaagccgaggctaaccgcattctctcgacgctgagcaactaccagttaaacgtc
agatttattacccaaaaagcaggtaaaaaagctgataaagtcatagacaccctagaaatt
gaaattgccgatagtcgtggtacccgtccctacgaaacctactctgggggcgaagtattt
cggattaattttgcaattaggttagcactagcaaggattactgcccaacgtatgggtgga
acgctacaaaccttaattattgatgaaggctttggtacccaagattctgagggttgcgat
cgcctactttctgctattaatgccatagcttcagactttgcctgtatcctagtaattacc
catatgccccaactcaaagaagcatttagcaccctaattgagatcacaaaaactgaatca
ggttcaaaaatcaaccttctggtttag

DBGET integrated database retrieval system