KEGG   Synechococcus sp. PCC 7502: Syn7502_01669Help
Entry
Syn7502_01669     CDS       T02371                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase, large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
synp00630  Glyoxylate and dicarboxylate metabolism
synp00710  Carbon fixation in photosynthetic organisms
synp01100  Metabolic pathways
synp01120  Microbial metabolism in diverse environments
synp01200  Carbon metabolism
Module
synp_M00165  Reductive pentose phosphate cycle (Calvin cycle)
synp_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
synp_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:synp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Syn7502_01669
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Syn7502_01669
Enzymes [BR:synp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Syn7502_01669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AFY73725
UniProt: K9SU87
LinkDB All DBs
Position
complement(1660201..1661631)
Genome map
AA seq 476 aa AA seqDB search
MAYSQTKTQAKAGYKAGVQDYRLTYYTPDYTPKDTDILAAFRVTPQPGVPFEEAAAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVPGEDNQFIAYIAYPLDLFEEGSVTNLLTS
LVGNVFGFKALKALRLEDLRIPVAYLKTFQGPPHGIQVERDKINKYGRPLLGCTIKPKLG
LSAKNYGRAVYECLRGGLDFTKDDENINSQPFQRWRDRFLFVADAIHKAQAETGEIKGHY
LNVTAGTVEEMLKRAEFAKELNMPIIMHDFLTAGFTANTTLAHWCRDNGVLLHIHRAMHA
VIDRQKNHGIHFRVLAKCLRMSGGDHIHTGTVVGKLEGDKAITLGFVDLLRENYVEQDKT
RGIYFTQDWASMPGVMAVASGGIHIWHMPALVEIFGDDSVLQFGGGTLGHPWGNAPGATA
NRVALEACVEARNEGRDLYREGGDIIREAAKWSPELAVACELWKEIKFEFEAVDTV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcgtattcgcagacaaagactcaggcaaaagctgggtacaaagctggggttcaagac
tatcggttaacctattacactcccgactacacccctaaagacacagatattctggcagcc
ttccgtgttactccacagccaggtgtgccttttgaagaagcagcagcagctgttgccgcc
gaatcttctacaggtacatggacaactgtgtggactgatcttttaactgatcttgatcgc
tataaaggtcgttgttatgacatcgaacccgtacccggtgaagataaccagtttattgct
tatatcgcctatcctttggatttgtttgaagaaggctctgtaaccaacctattaacctcc
ttagttggtaacgtatttggtttcaaagcattaaaagctctacgtcttgaggatttacgc
attcctgttgcttacctcaaaactttccaaggacctcctcatggtatccaagtagagcgg
gacaaaatcaacaagtatggtcgtcctttactcggttgtactattaagcccaaattaggt
ctatctgctaaaaactacggtcgtgcagtatatgagtgcttacgtggtggtcttgacttt
acgaaagatgacgaaaatattaactctcagcctttccaacgttggcgcgatcgtttcctg
tttgtagctgatgctattcacaaagctcaagccgaaactggcgaaatcaaaggacactac
ctcaacgttactgctggtactgtggaagaaatgctaaagcgtgccgagtttgctaaagaa
ctcaatatgccaatcattatgcatgacttcttaacggctggatttactgctaatactacg
cttgcccactggtgtcgtgataatggtgtattacttcacattcaccgtgctatgcacgct
gtaattgaccgtcaaaaaaatcatggtattcacttccgtgtattggctaagtgcttgcgt
atgtctggtggtgaccatattcacactggtaccgttgttggtaaattagaaggtgataag
gcaattactttaggctttgtcgatctattgcgtgaaaattatgtagaacaagacaaaacc
cgtggtatttactttacccaagattgggcttctatgcctggggtaatggctgtagcttct
ggtggtatccacatttggcacatgcctgctctggtggaaatctttggtgatgattctgtt
ctgcaatttggtggtggtactttaggacatccttggggtaatgcacctggtgcaaccgct
aaccgtgtggcattggaagcttgcgttgaagctcgtaacgaaggtcgtgacctttatcgt
gaaggtggggatattattcgtgaagctgctaagtggtctcctgaacttgctgttgcttgc
gaactatggaaggaaatcaagtttgaatttgaggctgtggataccgtctaa

DBGET integrated database retrieval system