KEGG   Synechococcus sp. KORDI-49: KR49_00290Help
Entry
KR49_00290        CDS       T03345                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
synr  Synechococcus sp. KORDI-49
Pathway
synr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:synr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KR49_00290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:synr02000]
    KR49_00290
Enzymes [BR:synr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     KR49_00290
Transporters [BR:synr02000]
 Other Transporters
  Pores ion channels [TC:1]
   KR49_00290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 GST_N_4 GST_C Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AII44907
UniProt: A0A076H7V1
LinkDB All DBs
Position
complement(52081..53307)
Genome map
AA seq 408 aa AA seqDB search
MPPTPATPEAQSWEQLSQYIGQEPDRINGPTSSQAVLRLFGHSESDVRVTLYRDHHAWCP
YCQKVWLWLEFQRIPYRIRKVTMRCYGSKEPWFLQLVPSGMLPALELDGQLITESDVILL
SLEQAFGPLGLPLMDPRALELRQLERLLFRAWCLWLCSPGLRPRQQQQARDQFQRTAQRM
EQALEQTPGPWLDDQGPGGVDLVFVPYVERMNASLAYYKGYRLRREHPAIDRWFAALEQL
ETYRGTQSDMHTHAHDLPPQMGGCWPDVSESQQSLAEAIDRGDGLGQDETSWTDDDPKRT
TALALGRVMRHRDQLLALNPLGSERFDQPLRAALTQLITGRPCRPTSGSAAGLRYLRDRI
SVPRDMPLPAARLLRQCLEATAALDGPAAPRPLPIRDRYDQDPQAFLR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgccccctacaccggcaactcctgaagctcagagctgggagcagttaagtcagtacatc
ggccaggaaccggaccgcatcaacggtcccaccagctcccaggccgttctgcgtctgttc
gggcactccgaatccgacgtcagggtcaccctctaccgcgaccatcacgcctggtgccct
tactgccagaaagtgtggctgtggcttgagttccagcgcatcccgtaccgcatccgcaag
gtgacgatgcgctgctacggcagcaaggagccctggtttctgcagctggtgccatcggga
atgcttcccgcccttgagctggacggacagctgatcaccgaaagcgacgtgatcctgctg
agcctggagcaggccttcggaccgctcggcctgccgctgatggatccacgggctctggag
ctgcggcagctggagcgtctgctcttccgggcctggtgtctctggctctgctccccgggc
ctgaggccgagacagcagcagcaggcccgcgaccagttccagcgcacggcgcaacggatg
gaacaggccctggagcagacccctggtccgtggctggatgaccagggaccgggcggcgtg
gacctggtgttcgtgccctacgtggagcggatgaacgcctccctggcctactacaagggc
tatcgcctccgtcgcgaacatccggcgatcgatcgctggtttgcggctcttgaacagctg
gagacctaccggggcacccagagcgacatgcacacccatgcccatgatcttccgccgcag
atgggcggctgctggccggatgtttccgagagccagcagtcactggcggaagccattgat
cgcggcgacgggctcggacaggacgaaaccagctggaccgacgacgatccgaagcggaca
acagctcttgcccttggtcgggtgatgcgacaccgtgaccagctgctggcgctgaacccc
ctcgggagcgagcggttcgatcagcccctgcgcgccgcactgacccagctgatcaccgga
cgcccctgccgaccgacctccggaagtgcagccggactgcggtatctccgggatcgaatc
tccgttccgagagacatgccgctgccggcggcgcggctgctgcggcagtgtctcgaggcg
acggcagcactggatggcccggccgctccccgaccgctgccgatccgggatcgatacgac
caggatccccaggcctttctgagatag

DBGET integrated database retrieval system