KEGG   Synechococcus sp. KORDI-49: KR49_05210
Entry
KR49_05210        CDS       T03345                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
synr  Synechococcus sp. KORDI-49
Pathway
synr00010  Glycolysis / Gluconeogenesis
synr00020  Citrate cycle (TCA cycle)
synr00620  Pyruvate metabolism
synr01100  Metabolic pathways
synr01110  Biosynthesis of secondary metabolites
synr01120  Microbial metabolism in diverse environments
synr01200  Carbon metabolism
Module
synr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:synr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KR49_05210
   00020 Citrate cycle (TCA cycle)
    KR49_05210
   00620 Pyruvate metabolism
    KR49_05210
Enzymes [BR:synr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     KR49_05210
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Other DBs
NCBI-ProteinID: AII45853
UniProt: A0A076H9W2
LinkDB
Position
complement(865641..866975)
AA seq 444 aa
MATHDIFMPALSSTMTEGKIVEWLKQPGDKVGRGESVLVVESDKADMDVESFQDGYLAAV
LMPAGSTAPVGETIGLIVESEAEIADAKASAPAAPAAAAPAPTATAPAPAPTPAPAPVAA
AAPVAAPPPAAIQPSAPVVNDGRIVASPRAKKLASQMGVDLATVRGSGPHGRIQAEDVEK
ASGQPISVPRVAEGTAPAVTGGASSAAAAPAAPAGSSFGRPGETVPFNTLQGAVNRNMEA
SLAVPCFRVGYTITTDKLDAFYKQVKPKGVTMTALLAKAVAVTLARHPQVNAATTAAGMA
YPADVNVAVAVAMEDGGLITPVLRNADRTDLYEMSRQWGDLVKRSRSKQLQPEEYSTGTF
TLSNLGMFGVDRFDAILPPGTGAILAVAASRPTVVAGKDGSIAVKRQMQVNLTADHRVIY
GADGAAFLKDLAELIETRPESLAL
NT seq 1335 nt   +upstreamnt  +downstreamnt
ttggcaacccacgacatcttcatgcctgccctcagctccaccatgacggagggcaagatc
gtggaatggctgaagcaacccggcgacaaggtcggacggggggagtcggtgctcgtggtc
gagtccgacaaggccgacatggatgtggagtcctttcaggacggctatctggccgcggtg
ctgatgccggccggcagcaccgcgccggtgggcgagacgatcggactgatcgtggaaagc
gaggcggagatcgctgatgccaaggcctcggctccggcagcccccgctgccgctgctcct
gcaccgacggccacagctcctgctcccgcaccgacgcctgcccccgcaccggtggctgcg
gcagctcccgtggcagctccgcctccggcagccattcagccgtctgctccggttgtcaac
gacggccgcatcgtcgccagcccccgtgccaagaagctggcgtctcagatgggcgtggat
ctggccaccgtgcgcggcagcggcccccacggccggatccaggcagaggacgtggagaag
gcgagcggtcaaccgatctccgttccgagggtcgccgagggcacagctcctgccgtcact
ggaggcgcgtcctctgctgcagcggcaccggccgcaccggctggcagcagcttcgggcga
cccggtgagaccgtgcccttcaacaccctgcagggggcggtcaaccgcaatatggaagcc
agcctggcggtgccctgcttccgtgtcgggtacacgatcaccaccgacaagctggatgcc
ttctacaaacaggtgaagcccaagggcgtcaccatgaccgccctgctggccaaggccgtg
gccgtcacgctggctcgccatccccaggtgaatgccgccaccacggcggccggtatggcc
taccccgccgacgtgaacgtggccgtggccgtggccatggaggacggcggcctgatcacg
ccggtgctgcgcaatgccgaccgcaccgatctctatgagatgtcacgccagtggggtgat
ctggtgaagcgctcccgcagcaagcagctgcagccggaggaatacagcaccggtaccttc
accctctccaatctcggcatgttcggtgtcgatcgcttcgatgcgatccttcctcccggc
accggcgcgatcctggcggtggcggcatcacgccccaccgtggtggccggcaaggacggt
tccatcgccgtgaagcgtcagatgcaggtgaatctgaccgccgatcaccgggtgatctac
ggggctgacggtgcggccttcctgaaggatctggcggagctgatcgagacccgccccgag
agtctggcgctctga

DBGET integrated database retrieval system