KEGG   Synechococcus sp. KORDI-49: KR49_11160Help
Entry
KR49_11160        CDS       T03345                                 

Definition
(GenBank) hypothetical protein
  KO
K02289  phycocyanobilin lyase subunit beta [EC:4.4.1.32]
Organism
synr  Synechococcus sp. KORDI-49
Pathway
synr00196  Photosynthesis - antenna proteins
synr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:synr00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    KR49_11160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:synr00194]
    KR49_11160
Enzymes [BR:synr01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.32  C-phycocyanin alpha-cysteine-84 phycocyanobilin lyase
     KR49_11160
Photosynthesis proteins [BR:synr00194]
 Antenna proteins
  Phycobilisome - Cyanobacteria, Red alga [OT]
   Phycocyanin (PC)
    KR49_11160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEAT_2 HEAT_PBS HEAT
Motif
Other DBs
NCBI-ProteinID: AII46962
UniProt: A0A076HE12
LinkDB All DBs
Position
complement(2041359..2041994)
Genome map
AA seq 211 aa AA seqDB search
MPSVALDSAIRHLDDARTTPELVRATQAICALEDPAAAPTLIKVLGYNNPAVAAVATQGL
IALGRAIVPTLLMSLDAQNYGARAWVVRVIAALRDPRGLELLDRALQADIAPSVRRAATR
GLAELDLVGSTAPADLSRCYLALFRAARDDEWVVRYAAAYGLERRLSLTPPPEPLADRGC
ALLQELSEECRENVKVVRLRAQLALQRLSIG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgccatcggttgccttggacagtgccatccgtcacctggatgacgccagaaccactccc
gagctggtgcgtgcaactcaggccatctgcgccctggaagatccagcggcggctcccacc
ttgatcaaggtgctcggttacaacaatccagcggttgccgccgtggccacgcaagggctg
atcgctctgggccgagccatcgtccccaccctgctgatgagccttgatgctcagaactat
ggcgcgagagcatgggtcgtgcgggtcatcgccgccctgcgggatcccaggggcctggag
ctgctcgatcgcgccctccaggcagacatcgctcccagtgtgagacgtgcagcgacccgt
gggctcgctgaactcgacctcgtcggttccacggcaccggctgatctgtcgcgctgttat
ctcgccctctttcgcgctgcccgtgacgatgagtgggtggtgcgatatgcggctgcctac
ggcctggaacgacggctcagcctgacgccaccgccagagcccctggcagatcgggggtgc
gcgctcctgcaggagttgtcagaggaatgccgtgaaaatgtcaaggtggtgcgtctgcgg
gcccagctcgccctccaacgcctgtccatcggatga

DBGET integrated database retrieval system