KEGG   Synechococcus sp. KORDI-49: KR49_12810Help
Entry
KR49_12810        CDS       T03345                                 

Gene name
chlL
Definition
(GenBank) protochlorophyllide reductase
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
synr  Synechococcus sp. KORDI-49
Pathway
synr00860  Porphyrin and chlorophyll metabolism
synr01100  Metabolic pathways
synr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:synr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KR49_12810 (chlL)
Enzymes [BR:synr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     KR49_12810 (chlL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH AAA_31 CbiA ArsA_ATPase ParA AAA_24 MeaB SRP54 MipZ NB-ARC AAA_25 AAA_16 CBP_BcsQ Rhamno_transf AAA_26 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AII47272
UniProt: A0A076HEW5
LinkDB All DBs
Position
complement(2352264..2353154)
Genome map
AA seq 296 aa AA seqDB search
MTTTLTRPADGEGSVQVHQDPSMNIQEETLVIAVYGKGGIGKSTTSSNLSAAFSKLGKRV
LQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPEDFVFTGFNGVQCVESGGPPA
GTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFD
SIFAMNRIVQAIQAKAKNYKVRLGGVVANRSADTDQIDKFNARTGLRTMAHFKDVDAIRR
SRLKKCTIFEMDDDDEAVQAVRREYLRLAQNMLENVEPLEATSLKDREIFDLLGFD
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgaccctgacgcggccggctgacggcgaaggcagtgtgcaggtccatcaggac
ccctcgatgaacatccaggaggaaaccctggtgatcgctgtctacggcaagggcggcatc
ggcaaatccaccacgtcctccaatctttcggccgctttctcgaagctgggcaaacgggtg
ctgcagatcggttgcgatccgaagcacgacagcacgttcaccctcacccacaagatggtg
ccgacggtgatcgacatcctcgaggaggtggacttccacagcgaggagctgcgtccggag
gacttcgtgttcaccggcttcaacggcgttcagtgtgtggagagcggcggccctccggcg
ggcaccggatgcggtggctacgtcacgggccagaccgtgaagctgctcaaggagcaccac
ctgctggaagacaccgatgtggtgatcttcgatgtgctcggcgatgtggtgtgcggcgga
tttgctgcaccgctgcagcacgccaattactgcctgatcgtgacggcgaacgatttcgat
tcgatcttcgcgatgaaccggatcgtgcaggcgatccaggccaaggccaagaactacaaa
gtgcggctgggcggtgtcgtcgccaatcgctccgcagacaccgatcagatcgacaagttc
aatgcccgcacgggcctgcgcacgatggcccacttcaaggatgtggatgccatccgccgc
tcacggctgaagaagtgcaccatcttcgaaatggacgatgacgacgaagcggtgcaggcg
gtgcgccgggagtacctgcgcctggcccagaacatgttggagaacgtggaacccctggaa
gccacatccctgaaagatcgggagatcttcgacctgctgggcttcgactga

DBGET integrated database retrieval system