KEGG   Synechococcus sp. KORDI-49: KR49_12850Help
Entry
KR49_12850        CDS       T03345                                 

Gene name
rbcL
Definition
(GenBank) ribulose bisophosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
synr  Synechococcus sp. KORDI-49
Pathway
synr00630  Glyoxylate and dicarboxylate metabolism
synr00710  Carbon fixation in photosynthetic organisms
synr01100  Metabolic pathways
synr01120  Microbial metabolism in diverse environments
synr01200  Carbon metabolism
Module
synr_M00165  Reductive pentose phosphate cycle (Calvin cycle)
synr_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
synr_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:synr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    KR49_12850 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    KR49_12850 (rbcL)
Enzymes [BR:synr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     KR49_12850 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AII47280
UniProt: A0A076HBX3
LinkDB All DBs
Position
2358925..2360340
Genome map
AA seq 471 aa AA seqDB search
MSKKYDAGVKEYRDTYWTPDYVPLDTDLLACFKCTGQEGVPKEEVAAAVAAESSTGTWST
VWSELLTDLDFYKGRCYRIEDVPGDKESFYAFIAYPLDLFEEGSITNVLTSLVGNVFGFK
ALRHLRLEDLRFPLAFIKTCYGPPNGIQVERDRMNKYGRPLLGCTIKPKLGLSGKNYGRV
VYECLRGGLDFTKDDENINSQPFQRWQNRFEFVAEAIKLSEQETGEKKGHYLNVTANTPE
EMYERAEFAKELGMPIIMHDFITGGFTANTGLSKWCRKNGMLLHIHRAMHAVIDRHPKHG
IHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGYIDQLRESFVPEDRSRGNFFDQDW
GSMPGVFAVASGGIHVWHMPALVTIFGDDSVLQFGGGTHGHPWGSAAGAAANRVALEACV
KARNAGRHLEKESRDILMEAAKHSPELAIALETWKEIKFEFDTVDKLDVQG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaagtacgacgctggggtcaaggagtacagggacacttactggactcctgat
tacgttcccctcgacaccgacctgctggcctgcttcaaatgcaccggccaggaaggcgtt
cccaaggaggaagtggccgctgctgtggctgctgaatcctccaccggcacctggtccact
gtgtggtccgagctcctcaccgatctcgacttctacaaaggccgctgctaccgcatcgag
gacgtccctggtgacaaggagtccttctacgccttcatcgcctaccccctcgacctgttc
gaggaagggtccatcaccaacgttctgacctcactggtcggcaacgtgttcggcttcaag
gccctgcgccacctgcgtctcgaagacctgcgcttcccgctggccttcatcaagacctgc
tacggcccgccgaacggcatccaggtcgagcgcgaccggatgaacaagtacggccgtcct
ctgctgggttgcaccatcaagccgaagctcggcctgagcggtaagaactacggccgtgtc
gtctatgagtgccttcgcggcggtctggacttcaccaaggacgacgagaacatcaactcc
cagccgttccagcgttggcagaaccgcttcgaattcgttgcggaagccatcaagctgtcc
gagcaggagaccggcgagaagaagggtcactacctcaacgtgaccgccaacactcccgag
gagatgtacgagcgcgctgagttcgccaaggaactcggcatgccgatcatcatgcacgac
ttcatcaccggcggcttcacagccaacaccggtctgtcgaagtggtgccgcaagaacggc
atgttgctgcacatccaccgcgccatgcacgcggtgatcgaccgtcatcccaagcacggc
attcacttccgcgtcctcgccaagtgtctgcgtctgtccggtggtgaccagctccacacc
ggcaccgtggtcggcaagctcgagggtgaccgtcagaccaccctcggctacatcgaccag
ctgcgcgaatcgttcgtgcccgaagaccgcagccgcggcaacttcttcgatcaggactgg
ggctccatgcccggcgtgttcgccgtcgcctccggcggtatccacgtgtggcacatgccc
gccctggtcaccatcttcggcgacgactccgttctgcagttcggtggtggtacccacggt
cacccctggggttccgctgcaggtgctgcggccaaccgcgtggccctcgaggcctgcgtc
aaggcccgcaacgccggccgccatctcgagaaagagagccgcgacatcctcatggaagcc
gctaagcacagccccgagctggcgatcgccctcgagacctggaaggagatcaagttcgag
ttcgacaccgtcgacaagctcgacgttcagggctga

DBGET integrated database retrieval system