KEGG   Synechococcus sp. KORDI-49: KR49_12855Help
Entry
KR49_12855        CDS       T03345                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
synr  Synechococcus sp. KORDI-49
Pathway
synr00630  Glyoxylate and dicarboxylate metabolism
synr00710  Carbon fixation in photosynthetic organisms
synr01100  Metabolic pathways
synr01120  Microbial metabolism in diverse environments
synr01200  Carbon metabolism
Module
synr_M00165  Reductive pentose phosphate cycle (Calvin cycle)
synr_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
synr_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:synr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    KR49_12855
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    KR49_12855
Enzymes [BR:synr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     KR49_12855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AII47281
UniProt: A0A076HCY7
LinkDB All DBs
Position
2360413..2360754
Genome map
AA seq 113 aa AA seqDB search
MPFQSTVGDYQTVATLETFGFLPPMTQDEIFDQIAYIIAQGWSPLIEHVHPSNSMASYWS
YWKLPFFGEKDLNVVVSELEACHRAYPDHHVRIVGYDAYTQSQGSCFVVFEGR
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcctttccagagcacagtgggtgactatcaaacagtcgccaccctggagaccttcggc
tttctcccgccgatgacccaggacgagatctttgaccagatcgcctacatcattgcccag
ggctggagcccgctcatcgagcacgtccaccccagcaactccatggcctcctattggtcc
tattggaagctccccttcttcggtgagaaggatctcaacgttgtcgtgagtgagctcgag
gcctgccatcgcgcttaccccgatcaccacgtgcgcatcgtcggttacgacgcctacacc
cagagccagggttcctgcttcgtggtcttcgaaggccgctga

DBGET integrated database retrieval system