KEGG   Synechococcus sp. WH 8103: SynWH8103_00368Help
Entry
SynWH8103_00368   CDS       T04859                                 

Gene name
accC
Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
synw  Synechococcus sp. WH 8103
Pathway
synw00061  Fatty acid biosynthesis
synw00620  Pyruvate metabolism
synw00640  Propanoate metabolism
synw01100  Metabolic pathways
synw01110  Biosynthesis of secondary metabolites
synw01120  Microbial metabolism in diverse environments
synw01130  Biosynthesis of antibiotics
synw01200  Carbon metabolism
synw01212  Fatty acid metabolism
Module
synw_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:synw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SynWH8103_00368 (accC)
   00640 Propanoate metabolism
    SynWH8103_00368 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SynWH8103_00368 (accC)
Enzymes [BR:synw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SynWH8103_00368 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SynWH8103_00368 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 ATP-grasp_5 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: CRY91115
UniProt: A0A0H5PN13
LinkDB All DBs
Position
complement(338063..339409)
Genome map
AA seq 448 aa AA seqDB search
MPIGKVLIANRGEIALRILRSCRELGIATVAVYSTVDKDALHVQLADEAVCVGDALSSKS
YLNVPNILAAATSRGVDAIHPGYGFLAENDKFAEMCGDHGLTFIGPSPHAIRSMGDKSTA
KATMQAVGVPTVPGSEGLLAGPQDAAVLAEQMGYPVMIKATAGGGGRGMRLVQSPDQLNN
LFKAAQGEAEAAFGNPGLYMEKFIDRPRHVEVQVLADRHGNVVHLGERDCSIQRRHQKLL
EEAPSPALDPDLRRRMGEAAVAAARSINYEGAGTVEFLLDRSGGFYFMEMNTRIQVEHPV
TEMVTGIDLIAEQLRIAGGEPISVQQGEINLSGHAIECRINAEDATHNFRPAPGRITGWL
PPGGPGVRVDSHVYTGYDIPPFYDSLIGKVIVWGRNRDVALSRMKRALNECAVTGIPTTV
EFHLALLDRPEFINGDVHTKFVEQDMLN
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcggcaaagtgctgatcgccaaccgcggcgaaattgccctccggatcttgcgc
agctgccgcgaactcggcatcgccaccgtggccgtttacagcacggttgataaagacgcg
ctccatgttcagctggccgatgaagcggtctgcgtcggcgacgccctgagcagcaagagc
tatctcaacgttcccaacatcctggccgccgccacctcccgcggggtcgacgcgatccat
cccggttacggcttcctggctgaaaacgacaaattcgccgagatgtgcggcgaccacggc
ctgaccttcatcggtccctccccccacgcgatccgctccatgggggacaaatccaccgcc
aaggccaccatgcaggccgtgggcgttccaaccgttcccggcagcgagggattgctggcg
ggaccacaggatgccgccgtgctggcggagcagatggggtatcccgtgatgatcaaagcc
accgccggaggcggcggccgtggcatgcgtctggtgcagagcccggaccagctgaacaat
ctgttcaaggccgcccagggagaggcggaggccgccttcggtaatcccgggctgtacatg
gagaaattcatcgatcgcccccggcacgtggaagtgcaggtgctggcggaccgccacggc
aatgtcgttcacctcggcgaacgggactgctcgattcagcgacgccatcagaaactgctg
gaggaagcccccagcccggccctggatcctgatctacgccgtcgcatgggtgaagcggcc
gtggccgcagcccgcagcattaactacgagggcgctggcactgtcgagttcctgctcgac
cgcagcggtgggttctatttcatggagatgaacacccgcatccaggtggagcatccggtg
acggagatggtgaccgggatcgacctgatcgccgagcaactgcgcattgccggtggagag
cccatcagcgttcagcagggggagatcaacctctccggccatgcgatcgaatgccggatc
aacgccgaagacgccacccacaatttccgaccagcacctgggcgcatcaccggctggctt
ccaccgggcggtcctggtgtccgtgtcgatagccatgtgtacaccggctacgacatcccg
ccgttctacgactctctgatcggaaaggtgatcgtctggggtcgcaaccgcgacgtggcg
ttatcgcggatgaaacgcgccctgaatgaatgcgccgtcactgggattcccaccacggtg
gaatttcatctagccctgctggatcgcccggagttcatcaacggcgacgttcacaccaag
ttcgtcgagcaggacatgctcaactga

DBGET integrated database retrieval system