KEGG   Synechococcus sp. WH 8103: SynWH8103_00769
Entry
SynWH8103_00769   CDS       T04859                                 

Gene name
pdhC_(aceF)
Definition
(GenBank) Pyruvate dehydrogenase complex, dihydrolipoamideacyltransferase (E2) component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
synw  Synechococcus sp. WH 8103
Pathway
synw00010  Glycolysis / Gluconeogenesis
synw00020  Citrate cycle (TCA cycle)
synw00620  Pyruvate metabolism
synw01100  Metabolic pathways
synw01110  Biosynthesis of secondary metabolites
synw01120  Microbial metabolism in diverse environments
synw01200  Carbon metabolism
Module
synw_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:synw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SynWH8103_00769 (pdhC_(aceF))
   00020 Citrate cycle (TCA cycle)
    SynWH8103_00769 (pdhC_(aceF))
   00620 Pyruvate metabolism
    SynWH8103_00769 (pdhC_(aceF))
Enzymes [BR:synw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SynWH8103_00769 (pdhC_(aceF))
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Other DBs
NCBI-ProteinID: CRY91508
UniProt: A0A0H5Q5W4
LinkDB
Position
663399..664724
AA seq 441 aa
MATHDIFMPALSSTMTEGKIVEWLKQPGDKVGRGESVLVVESDKADMDVESFQDGYLAAV
LMPAGSTAPVGETIGLIVETEAEIADAQAKATSAAPAASAPAPTPAPAAVQAPAPTPAPT
QAPAAPAPVAASAAPVANGRVVASPRAKKLASQMGVDLSTVRGSGPHGRIQAEDVEQAGG
QPISVPRVAEGTEAAVAASAAPSAAAPSAPAGNSFGRPGDTVAFNTLQGAVNRNMEASLA
VPCFRVGYTITTDKLDAFSKLVKPKGVTMTALLAKAVAVTLARHSQVNAATTAAGMTYPA
EVNVAIAVAMEDGGLITPVLRNADRTDLYEMSRQWKDLVKRSRSKQLQPEEYSTGTFTLS
NLGMFGVDRFDAILPPGTGAILAVAASRPTVVAGKDGSIAVKRQMQVNLTADHRVIYGAD
GAAFLKDLAELIEHRPESLAL
NT seq 1326 nt   +upstreamnt  +downstreamnt
ttggcgacccacgacatcttcatgcctgccctcagctccaccatgactgagggcaagatc
gtggaatggctgaagcaaccgggcgacaaggtcggtcggggtgagtctgtgcttgtcgtc
gagtccgacaaggccgacatggacgttgagtccttccaggatggctatctcgctgcagtg
ctgatgccggccggcagtacagcgcccgttggtgaaaccatcggcctgatcgtggagacc
gaggcggagatcgctgacgcccaggccaaggccaccagtgctgcgcccgccgcctcagcc
cctgcccccacaccggcccccgcagctgtgcaggctccggccccgacaccagctccgact
caggccccagcagctccggcaccggtggctgcctcagcagcgccggtggcgaacggacgg
gtggtggccagtcctcgggccaagaagttggcctcccagatgggcgtggacctcagcacc
gtgcgcggcagcggcccccacggccgcattcaggctgaggacgtggaacaagctggtggt
cagcccatctctgtgccccgggttgctgagggcactgaagctgctgttgccgccagcgca
gccccgtcggcggcggcccccagtgcgccggcgggcaacagcttcgggcgtcccggcgac
accgtcgccttcaacaccctccagggtgcggtgaaccggaacatggaggccagcctcgct
gtgccgtgtttccgtgtcggatacaccatcaccaccgacaagctggatgcgttctccaag
ctggtgaaacccaagggcgtcacgatgacggcgctgctggccaaggccgttgccgtcacc
ctggctcgccattcccaggtgaatgccgccaccaccgcggcaggcatgacctatcccgct
gaagtgaacgtggccattgctgtggcgatggaagacggcggcttgatcaccccggtgctg
cgcaatgccgaccgcacggatctctacgagatgtcgcgccagtggaaagatctggtgaag
cggtcccgcagcaagcagcttcagcctgaggaatacagcaccggaaccttcaccctctcg
aacctgggaatgttcggtgtggaccgcttcgatgcgattcttccccccggtaccggagcg
atcctggcggtggcagcctcccgccccacggttgtggcgggcaaggatggttccatcgcc
gtgaaacggcagatgcaggtgaacctcaccgctgatcaccgggtgatttacggcgctgat
ggtgcggcattcctcaaggatctggcggagttgatcgaacatcgccccgagagcctggcg
ctctga

DBGET integrated database retrieval system