KEGG   Synechococcus sp. WH 8103: SynWH8103_00769Help
Entry
SynWH8103_00769   CDS       T04859                                 

Gene name
pdhC_(aceF)
Definition
(GenBank) Pyruvate dehydrogenase complex, dihydrolipoamideacyltransferase (E2) component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
synw  Synechococcus sp. WH 8103
Pathway
synw00010  Glycolysis / Gluconeogenesis
synw00020  Citrate cycle (TCA cycle)
synw00620  Pyruvate metabolism
synw01100  Metabolic pathways
synw01110  Biosynthesis of secondary metabolites
synw01120  Microbial metabolism in diverse environments
synw01130  Biosynthesis of antibiotics
synw01200  Carbon metabolism
Module
synw_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:synw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SynWH8103_00769 (pdhC_(aceF))
   00020 Citrate cycle (TCA cycle)
    SynWH8103_00769 (pdhC_(aceF))
   00620 Pyruvate metabolism
    SynWH8103_00769 (pdhC_(aceF))
Enzymes [BR:synw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SynWH8103_00769 (pdhC_(aceF))
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: CRY91508
UniProt: A0A0H5Q5W4
LinkDB All DBs
Position
663399..664724
Genome map
AA seq 441 aa AA seqDB search
MATHDIFMPALSSTMTEGKIVEWLKQPGDKVGRGESVLVVESDKADMDVESFQDGYLAAV
LMPAGSTAPVGETIGLIVETEAEIADAQAKATSAAPAASAPAPTPAPAAVQAPAPTPAPT
QAPAAPAPVAASAAPVANGRVVASPRAKKLASQMGVDLSTVRGSGPHGRIQAEDVEQAGG
QPISVPRVAEGTEAAVAASAAPSAAAPSAPAGNSFGRPGDTVAFNTLQGAVNRNMEASLA
VPCFRVGYTITTDKLDAFSKLVKPKGVTMTALLAKAVAVTLARHSQVNAATTAAGMTYPA
EVNVAIAVAMEDGGLITPVLRNADRTDLYEMSRQWKDLVKRSRSKQLQPEEYSTGTFTLS
NLGMFGVDRFDAILPPGTGAILAVAASRPTVVAGKDGSIAVKRQMQVNLTADHRVIYGAD
GAAFLKDLAELIEHRPESLAL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
ttggcgacccacgacatcttcatgcctgccctcagctccaccatgactgagggcaagatc
gtggaatggctgaagcaaccgggcgacaaggtcggtcggggtgagtctgtgcttgtcgtc
gagtccgacaaggccgacatggacgttgagtccttccaggatggctatctcgctgcagtg
ctgatgccggccggcagtacagcgcccgttggtgaaaccatcggcctgatcgtggagacc
gaggcggagatcgctgacgcccaggccaaggccaccagtgctgcgcccgccgcctcagcc
cctgcccccacaccggcccccgcagctgtgcaggctccggccccgacaccagctccgact
caggccccagcagctccggcaccggtggctgcctcagcagcgccggtggcgaacggacgg
gtggtggccagtcctcgggccaagaagttggcctcccagatgggcgtggacctcagcacc
gtgcgcggcagcggcccccacggccgcattcaggctgaggacgtggaacaagctggtggt
cagcccatctctgtgccccgggttgctgagggcactgaagctgctgttgccgccagcgca
gccccgtcggcggcggcccccagtgcgccggcgggcaacagcttcgggcgtcccggcgac
accgtcgccttcaacaccctccagggtgcggtgaaccggaacatggaggccagcctcgct
gtgccgtgtttccgtgtcggatacaccatcaccaccgacaagctggatgcgttctccaag
ctggtgaaacccaagggcgtcacgatgacggcgctgctggccaaggccgttgccgtcacc
ctggctcgccattcccaggtgaatgccgccaccaccgcggcaggcatgacctatcccgct
gaagtgaacgtggccattgctgtggcgatggaagacggcggcttgatcaccccggtgctg
cgcaatgccgaccgcacggatctctacgagatgtcgcgccagtggaaagatctggtgaag
cggtcccgcagcaagcagcttcagcctgaggaatacagcaccggaaccttcaccctctcg
aacctgggaatgttcggtgtggaccgcttcgatgcgattcttccccccggtaccggagcg
atcctggcggtggcagcctcccgccccacggttgtggcgggcaaggatggttccatcgcc
gtgaaacggcagatgcaggtgaacctcaccgctgatcaccgggtgatttacggcgctgat
ggtgcggcattcctcaaggatctggcggagttgatcgaacatcgccccgagagcctggcg
ctctga

DBGET integrated database retrieval system