KEGG   Synechococcus sp. WH 8103: SynWH8103_01969Help
Entry
SynWH8103_01969   CDS       T04859                                 

Gene name
rbcS
Definition
(GenBank) Ribulose bisphosphate carboxylase, small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
synw  Synechococcus sp. WH 8103
Pathway
synw00630  Glyoxylate and dicarboxylate metabolism
synw00710  Carbon fixation in photosynthetic organisms
synw01100  Metabolic pathways
synw01120  Microbial metabolism in diverse environments
synw01200  Carbon metabolism
Module
synw_M00165  Reductive pentose phosphate cycle (Calvin cycle)
synw_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
synw_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:synw00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SynWH8103_01969 (rbcS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SynWH8103_01969 (rbcS)
Enzymes [BR:synw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SynWH8103_01969 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: CRY92687
UniProt: A0A0H5PU85
LinkDB All DBs
Position
complement(1612154..1612495)
Genome map
AA seq 113 aa AA seqDB search
MPFQSTVGDYQTVATLETFGFLPPMTQDEIYDQIAYIIAQGWSPLVEHVHPSNSMATYWS
YWKLPFFGEKDLNVVVSELEACHRAYPDHHVRIVGYDAYTQSQGACFVVFEGR
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcctttccagagcaccgtgggtgactaccaaacagtcgccaccctggagaccttcggc
ttcctcccgccgatgacccaggacgagatctacgaccagatcgcgtacatcattgcccag
ggttggagcccgctcgttgagcacgtccatcccagcaactccatggccacctactggtcg
tattggaagctccccttcttcggtgagaaggatctgaacgttgtcgtcagtgagctcgag
gcttgccaccgcgcataccccgaccaccacgtgcgcatcgtcggttacgacgcttacacc
cagagccagggtgcatgcttcgtggttttcgaaggacgctga

DBGET integrated database retrieval system