KEGG   Synechococcus sp. WH 8103: SynWH8103_02236Help
Entry
SynWH8103_02236   CDS       T04859                                 

Gene name
glpK
Definition
(GenBank) glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
synw  Synechococcus sp. WH 8103
Pathway
synw00561  Glycerolipid metabolism
synw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:synw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SynWH8103_02236 (glpK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:synw04147]
    SynWH8103_02236 (glpK)
Enzymes [BR:synw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SynWH8103_02236 (glpK)
Exosome [BR:synw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SynWH8103_02236 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C
Motif
Other DBs
NCBI-ProteinID: CRY92945
UniProt: A0A0H5QA11
LinkDB All DBs
Position
1826350..1827855
Genome map
AA seq 501 aa AA seqDB search
MADQPLLLALDQGTSSSRAAVFDAKGDLVASATAPLPIQYPADGWVEQHPGDIWNSQRQA
LQDLHQQLDEEQRRAVVSCGITNQRETTVLWRRSSGSPCGPALVWQDGRTADICQAWKAD
GLESAWCQRTGLLLDPYFSASKIRWMLEHHPEAAAAAAQGDLCFGTVESWLLWNLTGGQR
HGSDMSNASRTLLMDLEQRCWMDEFREQTGLPANALPELLPCRGEFGHIAAKLPFAGLPI
QALLGDQQAATLGQLCLQPGEAKCTYGTGAFLVINTGDSIRRSSDGLLSTLGWTDASGTP
TYCLEGSLFNAGTVVQWLRDGLQIIEQADEVNALAQSVPDSGGVMLVPAFTGWGTPHWDP
QARGVLVGLTRDSNRGHIARAALEGIALSVATLVELAGEALGRGLGELAVDGGAAASDPL
LQAQADSTGLTVRRPRNLESTARGIALFAGVQCGLIPDLSAIAAHRQDDVQRFEPQINTE
RRRLQRDRWNDAVNRSLGWHG
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcagcctctcctgttggcgctggatcaaggcaccagcagttcccgagcagcg
gtgtttgacgccaagggcgaccttgtggccagtgcgacggcgcccctaccaatccaatac
cccgccgatggctgggtggaacaacaccccggcgacatctggaacagccaaaggcaggca
ctgcaggatctgcaccaacagctcgatgaggagcaacgtcgggccgtggtgagctgcggc
atcaccaatcaacgcgaaaccacggtgctctggcgtcgcagcagcggcagcccctgcgga
ccggccctggtctggcaggacggccgtacagcagacatctgccaagcctggaaagcagac
ggcctcgaatccgcgtggtgccagcgcaccggcttgctgctggatccgtacttcagcgcc
agcaagatccgttggatgctcgagcatcaccccgaggcggcagccgctgcggcccagggc
gatctgtgcttcggcacggtggagtcgtggctgctctggaacctcacgggaggacagcgc
cacggcagtgacatgagcaatgccagccgcacgctgctgatggatctcgagcagcgctgt
tggatggatgaattccgcgaacagacgggtcttcctgcgaacgctctaccggagctgttg
ccctgtcgtggggagttcggccacatcgcagcgaagcttcccttcgccggattgcccatc
caggccctcctcggtgatcaacaggccgcgacccttggtcagctctgtctgcagcctggc
gaagccaaatgcacctatggcactggggcctttctggtgatcaataccggcgacagcatc
cgccgctccagcgacggtctactcagcacccttggctggaccgatgccagcggcacaccc
acctactgcctggagggcagcctgttcaatgcaggaactgtggtgcagtggctgagggac
ggcttgcagatcatcgagcaggctgatgaggtgaatgccctggcgcaatcggtgccggac
agcggcggggtgatgctggtgcccgccttcaccggttgggggaccccccactgggacccc
caggcccgcggtgtgctggtggggctcacgcgggacagcaaccgcggccacatcgcccga
gccgccctggagggcatcgccctgtcggtggccaccctggtggagctggcgggagaggcc
ctcggccgtggcctgggggaactggcggtggatgggggggctgccgcctccgatcccttg
ttgcaggcgcaggcggacagcaccggcctgacggtgcgccgcccccggaacctggaaagc
acagcccgcggcatcgctctgtttgccggtgtgcaatgcggcctgatccccgacctgtcc
gccatcgccgcccaccggcaggacgatgtacagcgcttcgaaccgcagatcaacaccgag
cggcgcaggcttcaacgtgaccgctggaatgacgccgtgaaccgcagcctgggctggcat
ggctga

DBGET integrated database retrieval system