KEGG   Synechococcus sp. WH 8103: SynWH8103_02354Help
Entry
SynWH8103_02354   CDS       T04859                                 

Gene name
ppc
Definition
(GenBank) Phosphoenol pyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
synw  Synechococcus sp. WH 8103
Pathway
synw00620  Pyruvate metabolism
synw00680  Methane metabolism
synw00710  Carbon fixation in photosynthetic organisms
synw01100  Metabolic pathways
synw01120  Microbial metabolism in diverse environments
synw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:synw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SynWH8103_02354 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SynWH8103_02354 (ppc)
   00680 Methane metabolism
    SynWH8103_02354 (ppc)
Enzymes [BR:synw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SynWH8103_02354 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CRY93047
UniProt: A0A0H5PV83
LinkDB All DBs
Position
1915798..1918830
Genome map
AA seq 1010 aa AA seqDB search
MINRSPETSGASMPQSTAHVPDGEQPRASGGSPGAGRLLQHRLELVEDLWQTVLRSECPP
EQSERLLRLKQLSDPVALEGRDGESSSEAIVELIRSMDLSEAIAAARAFSLYFQLINILE
QRIEEDSYLDSLRPSRSQDDETAAPFDPFAPPLASQTDPATFGEVFERLRRMNVPPAQVE
TLLRELDIRLVFTAHPTEIVRHTVRHKQRKVASLLQRLQSEPALPRYDEEELRRQLEEEI
RLWWRTDELHQFKPTVLDEVDSTLHYFQQVLFEAMPQLRRRLVSSLSRHYPDVQFPQASF
CTFGSWVGSDRDGNPSVTPEITWRTACYQRQLMLELYIGSVQSLRNQLSISMQWSQVAPP
LLESLEMDRLRFPEIYERRAARYRLEPYRLKLSYILERLELTLQRNHQMSEAGWQSPPEP
AATAPTDGIPGHEALHYTAIDQFRSDLELIRNSLVSTELSCEQLDTLLNQVHIFGFSLAS
LDIRQESTRHSDAIDELTTHLQLPKAYGAMEESERVAWLLEELQTRRPLIPAAVEWSEAT
AQTFAVFQMLHRLQQEFGQRICHSYVISMSHTASDLLEVMLLAKEIGLVDPQAGKASLLV
VPLFETVEDLQRAPAVMDGLFQTPIYRNLLPSVGVQRQPLQELMLGYSDSNKDSGFLSSN
WEIHQAQIALQTLASSHGVALRLFHGRGGSVSRGGGPAYQAILAQPSGTLQGRIKITEQG
EVLASKYGLPELALYNLETVTTAVVQNSLVTNQLDATPSWNQLMSRVAKRSREHYRALVH
DNPDLVAFFQQVTPIEEISKLQISSRPARRKTGARDLSSLRAIPWVFGWTQSRFLLPSWF
GVGTALAEEVNDDPEQLDLLRRLHQRWPFFRMLISKVEMTLSKVDLDLAHHYMSSLGNPE
QRDAFEGIFKVIADEYGRTLKLVLEITGQSRLLGADQNLQLSVDLRNRTIVPLGFLQVAL
LRRLRDQNRQPPMSESPGTPEDRRTYSRSELLRGALLTLNGIAAGMRNTG
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatcgcagtcccgagaccagcggagcgtcgatgccccagtccaccgcccatgtc
cccgacggcgagcagccaagggccagcggtggcagccccggcgccggccgcctgctgcag
catcgcctcgagctggtggaagacctgtggcagaccgtgctgcgcagcgaatgccccccg
gaacaaagcgagcgactgcttcgcctcaagcagctgagtgatccggtggccctggaaggc
cgcgacggtgagagcagcagcgaggcgatcgttgagctgatccgcagcatggatctctcc
gaggccatcgcagcagcccgtgctttctcgctgtatttccagctgatcaacatcctcgag
cagcgcatcgaagaagacagctatctcgacagccttcgtcccagccgcagccaggacgac
gagaccgcggcgccctttgatcccttcgcgccgcccctggccagccagaccgaccccgcc
acattcggcgaggtgttcgagcggctgcggcggatgaacgttccccccgcgcaggtggag
acgctcctgcgggaactggacatccgactggtgttcaccgcccacccgacggaaatcgtg
cggcacaccgtgcggcacaaacagcggaaggtggcctccctgctgcagcggttgcagtca
gagccagcgctgccccgctacgacgaagaggaattgcgacgccagctggaggaggagatc
cgcctctggtggcgcaccgatgagctgcaccagttcaaaccgacggtgctggatgaggtg
gattcaaccctgcactacttccagcaggtgctgttcgaggcgatgccgcagctgcggagg
cggctggtgtcatccctgagccggcactaccccgatgtgcagttcccccaggcgtccttc
tgcaccttcgggtcctgggtggggtccgaccgcgacggcaacccctcggtcaccccggag
atcacctggcggaccgcctgttatcagcgccagctgatgctggagctctacatcggctcg
gtgcaatccctgcgcaaccagctgagcatctcgatgcagtggagccaggtggccccacca
ctgctggaatcgctggaaatggaccggctgcgcttcccggaaatctatgagcgccgggcc
gcccgctatcggctggagccctaccggctcaagctcagctacatcctcgaacggctggag
ctcacgctgcagcgcaaccatcagatgtcggaggctggctggcagtcgccgcccgaaccc
gccgccacagcgccaaccgatgggatcccgggccatgaggcgctgcactacaccgccatc
gatcagttccgcagtgatctggaactgatccgcaacagcctcgtcagcaccgagctgagc
tgcgaacagctcgacaccctgctcaatcaggtccacatcttcgggttctccctggcgagc
ctggacatccggcaggagagcacccgccacagcgacgccatcgatgagctgaccacccac
ctgcagcttccaaaggcctacggcgccatggaggaatccgagcgggtggcctggctgctg
gaggaactgcagacccgccggccgctgatccccgcggcggtcgaatggtccgaagccacc
gcccagacctttgcggtgttccagatgctgcatcgcctgcagcaggaattcggtcagcgg
atctgccactcctacgtgatctccatgagtcacaccgcctccgacctgctggaggtgatg
ctgctggcgaaggagatcggccttgtggacccgcaggccggcaaggcatcgctgttggtg
gtacccctgttcgaaacggtggaagacctgcagcgggccccagcggtgatggacggcctg
ttccagacgccgatctaccggaatctgctccccagtgtcggcgtccagcgacagcccctg
caggagctgatgctcgggtactccgacagcaacaaggactcgggcttcctctccagcaac
tgggagattcaccaggcgcagatcgccctgcaaaccctggccagcagccacggtgtggcc
ctacggctgttccacggccggggtggatcggtgagccgcggcggcggcccggcctaccag
gccatccttgcccagcccagcggcacactgcagggccggatcaagatcaccgaacagggt
gaggtgctggcctccaagtacggcctgccggaacttgccctttacaacctggaaaccgtc
acgacggcggtggtgcagaacagcttggtgaccaaccagctggatgccaccccgagctgg
aaccagttgatgagccgcgtggccaaacgctcccgcgagcattaccgggccctggtccac
gacaaccccgatctggtggcgtttttccagcaggtcaccccgatcgaggagatcagcaag
ctgcagatctccagccgtccggctcgccgcaagaccggcgcccgggatctctccagtctg
cgggcaatcccctgggtgttcggctggacccaaagccggttcctgctgccgagctggttc
ggtgtgggcaccgccctggcggaggaggtcaacgacgaccctgagcaactggacctgctg
cggcgactgcatcagcgctggccgtttttccggatgctgatttccaaggtggagatgacg
ctgtccaaggtcgatctcgacctggcgcaccactacatgagcagcctcggcaacccggag
cagcgcgatgcctttgaaggcatcttcaaggtgatcgccgatgaatacggccgcaccctg
aagctggtgctcgaaatcaccggtcagagccgcctgctgggggccgatcagaacctgcag
ctgtcggtggatctgcgcaaccgcaccattgttcccctgggcttcctgcaggtggccctg
ctgcggcgactgcgggatcagaaccgccagcctcccatgagcgaatcccctggaacgccg
gaggaccgccgcacctacagccgcagtgaactgctgcggggcgcattgctcaccctcaac
ggcatcgccgccggcatgcgcaacaccggctga

DBGET integrated database retrieval system