KEGG   Synechocystis sp. IPPAS B-1465: C7I86_02525Help
Entry
C7I86_02525       CDS       T05368                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
syo  Synechocystis sp. IPPAS B-1465
Pathway
syo00250  Alanine, aspartate and glutamate metabolism
syo00410  beta-Alanine metabolism
syo00430  Taurine and hypotaurine metabolism
syo00650  Butanoate metabolism
syo01100  Metabolic pathways
syo01110  Biosynthesis of secondary metabolites
syo01120  Microbial metabolism in diverse environments
syo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:syo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    C7I86_02525
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C7I86_02525
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C7I86_02525
   00430 Taurine and hypotaurine metabolism
    C7I86_02525
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    C7I86_02525
Enzymes [BR:syo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     C7I86_02525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AVP88653
LinkDB All DBs
Position
complement(543468..544871)
Genome map
AA seq 467 aa AA seqDB search
MVHKKIDLNQLSEAESLLTPTYAARGLANSVSKYEMPETEMLPAIAYNLIHDELGLDGNS
RLNLATFVTTWMEPEARQLMADTFDKNMIDKDEYPQTAEIELRCVNILSRLWNAPASAEA
TGCSTIGSSEAAMLGGMAMKWKWRQRRQAAGKPGDRPNLVMGINVQVCWEKFCRYWEVEP
RFVPMEGDRYHISPEEAVKLIDENTIGVIGILGSTFDGSYEPIEALNDALETLNQRTGWQ
VPLHIDAASGGFIAPFLDPDLRWDFRLPWVKSINTSGHKYGLVYPGVGWIIWRDKEELPE
ELIFHCNYLGGDLPNFALNFSRPGNQVVAQYYNFLRLGKEGYRKIQQTCRDTALYLSGKI
AQLGPFELLTDGGDIPVFAWRLKDEVLANTCYTLYDMADKLRERGWLVPAYRMPKNREDL
VVQRIVVKEGFSRDMADLLLADMERAIAYFASQPDHKPKQEGSHFSH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggtgcataaaaaaattgacctcaaccagctcagtgaagcggaaagcctactgaccccc
acctatgcggcccggggcctagccaattctgtcagtaaatatgaaatgccagaaacggaa
atgctaccggcgatcgcctataacctcatccacgatgaactggggctagatggcaattcc
cgattaaacctggccacctttgtcaccacttggatggagccggaagctaggcaactgatg
gcggataccttcgacaaaaacatgatcgataaggatgaatatccccaaacggcggaaatt
gagttgcgttgcgtcaatattttgtcccgactctggaatgctccggccagtgcggaagcc
accggctgttccaccattggttctagtgaagcggccatgttgggggggatggccatgaag
tggaaatggcggcaacgacgacaagcggcagggaaaccaggcgatcgcccgaatttggtt
atgggcattaacgtccaggtttgttgggaaaagttttgtcgttactgggaagtggaaccc
cgctttgtccccatggaaggcgatcggtaccacatcagcccggaagaagcagttaagcta
attgacgaaaataccatcggtgtaattggtattttaggtagcacctttgacggcagttat
gaacccattgaagcgttgaacgatgccctggaaactttaaatcaaagaactggttggcag
gtgcctctgcacatagatgccgccagcggtggttttattgctccctttttagatccagat
ttgcgttgggattttcgtttaccttgggtgaaatccatcaacacctctggccacaaatac
ggtttagtttatccgggggtaggttggatcatttggcgggataaggaagaattaccggaa
gaattaattttccattgcaactatttggggggagatttacccaactttgccctcaacttt
tcccgccccggcaatcaggtagtggcccagtattataactttctccgcttaggcaaagaa
ggttaccgcaaaatccaacagacttgtcgagatacggctctgtatctatctggcaaaatt
gcccaattaggcccttttgaattgctcaccgacggtggggatatcccggtttttgcctgg
agattaaaggacgaagtattggccaacacttgttataccctgtacgacatggccgacaaa
ttgcgggaacggggctggttggtgcccgcctatcgcatgcccaaaaaccgtgaagatttg
gtggtgcaacgcattgtcgtgaaagagggttttagtcgggatatggcggaccttttgtta
gcggacatggaaagggcgatcgcctattttgccagccaaccggaccacaaaccgaagcag
gaaggttcccactttagccattag

DBGET integrated database retrieval system