KEGG   Synechocystis sp. IPPAS B-1465: C7I86_05720Help
Entry
C7I86_05720       CDS       T05368                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
syo  Synechocystis sp. IPPAS B-1465
Pathway
syo00473  D-Alanine metabolism
syo00550  Peptidoglycan biosynthesis
syo01100  Metabolic pathways
syo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:syo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C7I86_05720
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C7I86_05720
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    C7I86_05720
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:syo01011]
    C7I86_05720
Enzymes [BR:syo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C7I86_05720
Peptidoglycan biosynthesis and degradation proteins [BR:syo01011]
 Precursor biosynthesis
  Amino acid ligase
   C7I86_05720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AVP89222
LinkDB All DBs
Position
1223594..1224658
Genome map
AA seq 354 aa AA seqDB search
MRVGLLFGGCSGEHEVSIKSAQAIAKALASDDNQTKYQVSPFYIQKNGVWLGPDVSQQVL
DQGVPWGDQPVTAGQRWQFPPEAARMEVWFPILHGPNGEDGTVQGLFSLMQVPYVGSGVL
GSCVGMDKLAMKMVFERAGLPQVNYMGVERGEIWSNPCVFPALCEKIEAQVGYPCFVKPA
NLGSSVGIAKVRNRSELEAALDNAASYDRRIIVEAGLTDIREVECAVLGNENPQASVVGE
ITYDSDFYDYETKYTDGRSQMHIPANLPKAVVNQIQTMAIQAFKAVDAAGLGRLDFFYQP
TTGQIVINEINTLPGFTAFSMYPELWRASGVEFPSLVDRLLQLALDYHGRPGHQ
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtggggctgttatttggtgggtgttctggggagcatgaagtctcgatcaaatcc
gcccaggcgatcgccaaagcattggccagcgacgataaccaaaccaaatatcaagtaagc
cctttttatattcaaaaaaatggcgtttggctggggccagacgtttctcaacaggttttg
gaccagggagttccctggggggatcagcccgttacggccggacaacggtggcagtttccc
cccgaagcggcccgaatggaggtgtggtttcccattttgcacggccccaacggtgaagat
ggcacagtgcaggggttatttagtttgatgcaagtgccctatgtgggcagtggcgtgctg
ggttcctgtgtgggcatggataaattggcgatgaaaatggtctttgaacgggcagggttg
ccccaggtcaattacatgggggtagaacggggggaaatttggtctaatccctgtgttttt
ccggctttgtgcgaaaaaattgaagcccaggtgggctatccctgtttcgttaaaccggcc
aacttaggctcctccgtgggcattgccaaagtgcggaaccgtagtgaattggaagcagcc
ctagacaacgccgccagttacgatcgccgcatcattgtcgaagcgggtttaacggatatt
agggaagtggaatgtgcggtgctgggcaacgaaaatccccaagcttccgtggtgggggaa
atcacctacgacagcgacttttacgattacgaaaccaaatacaccgatggccgctcccaa
atgcatatccccgccaacttacctaaagctgtggtgaaccagatccagaccatggccatt
caagcttttaaagctgtggatgcggcgggcttaggacgattggactttttctatcaaccg
actacggggcagattgtcatcaacgaaattaacaccctgcctggtttcaccgcctttagt
atgtatcccgaactgtggcgagcttctggggtagaatttcctagcttagtggatcgatta
ttacagttggcattggactaccatggccgtcccggtcaccaataa

DBGET integrated database retrieval system