KEGG   Synechocystis sp. IPPAS B-1465: C7I86_06255Help
Entry
C7I86_06255       CDS       T05368                                 

Definition
(GenBank) cobalamin biosynthesis protein CobQ
  KO
K07009  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
syo  Synechocystis sp. IPPAS B-1465
Pathway
syo00550  Peptidoglycan biosynthesis
syo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C7I86_06255
Enzymes [BR:syo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     C7I86_06255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3
Motif
Other DBs
NCBI-ProteinID: AVP89321
LinkDB All DBs
Position
1328927..1329697
Genome map
AA seq 256 aa AA seqDB search
MELTIGWLYPKLMSTYGDRGNVICIQRRCQWRDIPVKILPLEQTSEAALFLQADLIVGGG
AQDRQQEIVMRDLQGSKAEALKNQLDDGIPGVFTCGSPQLLGHYYEPALGQRIQGLGLLD
MVSKHPGPEAKRCIGNVVFEITAEPLRQELQAMTGETPIVIGFENHGGRTYLQTVSPLGK
VKTGYGNNGEDGFEGAFHQKAIATYSHGPLLPKNPFLADWLIRTALEKKYQDSVQLTPLD
DCLAQQARAAMLKRLE
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggaattaacaatcggctggctttatcccaaactcatgagcacctacggcgatcggggc
aatgtcatttgcatccaacgtcgttgtcaatggcgggatatccctgtgaaaattctgccc
ctggaacagaccagcgaggcggcactgtttctccaagccgacttaattgtggggggcggg
gcccaggatcgccaacaggaaattgtcatgcgggatttgcaaggatccaaagcagaggcg
ctgaaaaatcagttagacgatggcattcccggagtattcacctgtggttctccccaactg
ctggggcattattacgagcctgccttagggcaacgcattcagggtttgggactgctggat
atggtcagtaaacatccaggaccagaagcaaaacgctgcattggtaacgtagtgtttgaa
attaccgctgaacccctccggcaagaattacaggctatgaccggggaaactcccattgtc
attggctttgaaaaccatggcggccgcacctatctccaaaccgtttctcccctgggtaag
gttaaaaccggctatggcaacaacggcgaagatggctttgagggggctttccaccaaaag
gcgatcgccacttactcccatggccctctgttgcccaaaaatccctttttagctgattgg
ttaatccgcacggcgttggagaagaagtatcaggattcggtgcagttaactcccttggat
gactgcctcgcccaacaagcccgcgccgccatgctcaaacggctagaatag

DBGET integrated database retrieval system