KEGG   Synechocystis sp. IPPAS B-1465: C7I86_09035Help
Entry
C7I86_09035       CDS       T05368                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
syo  Synechocystis sp. IPPAS B-1465
Pathway
syo00970  Aminoacyl-tRNA biosynthesis
syo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C7I86_09035
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:syo03029]
    C7I86_09035
Enzymes [BR:syo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     C7I86_09035
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     C7I86_09035
Mitochondrial biogenesis [BR:syo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    C7I86_09035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AVP89793
LinkDB All DBs
Position
complement(1903278..1904765)
Genome map
AA seq 495 aa AA seqDB search
MTATAVKTDYEAIIGLETHCQLNTASKIFCNCSTDFDSPPNTNVCPVCLGYPGVLPVLNE
EVLAAAVKLGLAINGQIAPYSKFDRKQYFYPDLPKNYQISQFDLPIVEHGSLEIELVDKK
TKEITRKTIGITRLHMEEDAGKLVHAGSDRLAGSTHSLVDFNRTGVPLLEIVSEPDLRTG
QEAAEYAQSLRQLVRYLGISDGNMQEGSLRCDVNISVRPVGQKEFGTKVEIKNMNSFSAI
QKAIEYEIERQIKAIADGEEIYQETRLWEEGSQRTISMRKKEGSSDYRYFPEPDLPPLEV
SEQQKQTWFATLPELPSAKRARYEQKLGLSAYDARVLTEDRDVALYFEEAVNAGADPKAV
ANWVTQDIAAYLNNNRLTISGLALKPSALAELIDLITKGTISGKIAKDILPELLEKGGSP
QKIIEARGLVQISDPDELTAIIQAVIADHPKELEKFRSGKGNMQGFFVGQVMKRTGGKAD
PKLTNQLIGKLLAQA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgactgccactgctgttaaaaccgattacgaagcgattattgggctagaaacccactgt
cagctcaacacagctagtaagattttttgtaattgctccactgattttgacagtcccccc
aacaccaatgtctgtccggtgtgtttgggttatccgggggttctgccagtgctcaatgaa
gaagtgttggcggcggcggttaaacttggcttagccatcaatggccagattgccccctac
agtaagtttgaccgcaagcagtatttttatccggatttacctaagaactatcaaatttcc
cagtttgatttgcccattgtggagcatggctccttggaaattgagttggtggataaaaaa
actaaagagattacccgcaaaaccattggcatcactcgtttacatatggaggaagatgcg
ggcaaattagtccatgcggggagcgatcgcctggcggggtcaacccattccctggtggat
ttcaatcgcactggggtacctttactagaaattgtttcggagccggatttacgcacgggg
caggaagcggcggagtatgcccagtctttacgccaactggtgcgttacctaggcattagc
gacggcaatatgcaagaaggttccctccgttgtgatgtaaatatttctgtgcgtccggtg
gggcaaaaggaatttggcaccaaggtggagatcaaaaacatgaactcctttagcgccatc
caaaaggcgatcgagtatgagattgaaaggcaaattaaggccatcgccgacggggaggag
atttaccaagaaacccgcctctgggaggaaggcagtcagcgcaccatcagcatgcgaaaa
aaggaaggctccagcgattatcgctattttcctgaaccggacttgccccccttagaagtg
tccgagcaacagaaacaaacttggtttgcaaccttgccggaactccccagtgccaaacgg
gcccgctatgaacagaaactgggtttatctgcctatgatgcccgggtattgaccgaagac
cgggatgtggcgctctattttgaggaagcggtgaatgccggagctgacccgaaagcagtg
gccaattgggttacccaggacattgccgcctacctcaacaacaaccgtttgaccatcagc
gggctggccctgaaaccgtcggccctggcggagttaattgatctaattaccaaaggcacc
attagcggcaaaattgccaaagatattctgccggagttgctggaaaaaggtggctctccc
cagaaaattattgaagctaggggcttggtgcaaatttctgaccccgacgagttgactgcc
atcatccaagctgtcattgctgaccatcccaaggagttggaaaaattccgcagtggtaag
ggcaatatgcagggtttctttgtcggtcaagtcatgaaacgtactggcggcaaggcagat
ccaaagttgactaatcaattaattggtaaactcctggcccaagcttaa

DBGET integrated database retrieval system