KEGG   Synechocystis sp. IPPAS B-1465: C7I86_09245Help
Entry
C7I86_09245       CDS       T05368                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
syo  Synechocystis sp. IPPAS B-1465
Pathway
syo00564  Glycerophospholipid metabolism
syo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C7I86_09245
Enzymes [BR:syo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C7I86_09245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 NAD_binding_8 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AVP89831
LinkDB All DBs
Position
complement(1946359..1948020)
Genome map
AA seq 553 aa AA seqDB search
MRNFPEIQNTAYDLIVIGGGINGVGTARDGALRGLKTLLIEKDDFASGTSSWSTRLIHGG
LRYLEYFEFNLVRESLREREVLLHTAPHLVQPLQLTIPVYDWSSRAYWEIQAGMILYDIL
SFDKTLPSHRMLSPQQFQQLFRAAEKKGLKGGAQYFDGQVEYAERLDLEVTLSAQKAGAA
MLNYVAVKGLEKGENNLITAIHCQDQLSGEKFTVNSAQAIVINTTGPWVDEVCGLAHRGG
EPVAIVQERKIGGTKGSHIVVDPFPGAPASALYVEAFVDKRPYFIIPWLGKYLIGTTDHR
YDGSLDRVKASDDEIDYLIAETNRVMPAAQLTRQDVRFTYSGVRPLPYTDGKKAGSITRN
HILYDHSQDGVNNLISLIGGKLTTYRQVGEEMVDKVYGKLRRSAPPCPTLTQPLPGAEAY
PLSLETAMDKYGNHLERHSIQHLFCLYGARAGDILALVHGAPELGERIIPSLPDIKAQVV
FAVQAEMAHTLVDICRRRTAIAMVTNDYGFSALAGICQTLTDHCGWTQEQCDKQIQKYHE
YMEQNCIPDYCLH
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatttcccagaaatccaaaatacggcctatgacctaattgtgattgggggaggc
attaacggggttggcacggcccgggacggagccctacggggcctaaaaaccctcctgatc
gaaaaggatgatttcgccagtggtacgagtagttggtccacccgcttaatccatggcggc
ctgcgctatctggaatattttgaatttaatctggtgcgggaatccctgcgggagcgggaa
gttctgctccacaccgccccccatttggtccagcccctccagttgaccattccggtgtac
gactggtcgagccgggcctattgggaaattcaggcgggcatgattctttacgacatcctc
agttttgataaaaccctcccttcccataggatgttaagcccccaacagttccagcaactg
ttccgagcggcggagaaaaaaggcttaaaaggaggagcccaatattttgacggccaggtg
gaatatgcggaacggttagatttagaagtgaccctatcggcccaaaaggccggggcggcc
atgctcaattatgtggctgtgaaggggttggagaaaggggaaaataacctgattaccgcc
atccattgccaggatcaactgagcggagaaaaatttactgttaatagcgcccaggcgatc
gtcattaataccactggcccctgggtagatgaagtttgtggcttagcccatcgaggggga
gaacccgttgccattgtccaagaaagaaaaattggtggcaccaagggcagtcatattgtg
gtggatcccttccctggagcccccgcttcagccttatatgtggaagcgtttgtggataaa
cggccctatttcatcattccctggttgggtaaatatctgattggcaccacggaccaccgc
tatgatggttccctcgacagggttaaagccagtgatgacgagattgattacctgattgcg
gaaactaaccgggtgatgccagcagctcagttaaccaggcaggatgtgcgtttcacctat
tccggggtgcgccctctgccctacaccgatggcaaaaaggccggcagtattacccgcaac
catattctttatgaccatagtcaagacggagttaataatttgatttccctaattggcggt
aagttgaccacctatcgccaggtgggagaagaaatggtggataaggtttatggcaagctg
agacgctctgctcctccctgtccaaccctgacccaacctttaccgggggcagaagcctat
cccctgtccttggaaactgccatggataaatatggcaatcatttggagcgtcattctatt
caacatttattttgcctttacggagccagggctggagacattttagccttagtccacgga
gcgccggagttgggggaaaggattattccttccttgccggatatcaaagcccaagttgtt
tttgcagtacaagcagaaatggcccacaccttggtggatatttgtcgacgacgtacggcg
atcgccatggtgactaacgattatggctttagcgccctggccggcatttgccaaacgtta
acagaccattgtggctggacccaggagcaatgtgacaagcaaattcaaaagtaccatgaa
tatatggagcaaaactgcattcccgactattgtctccactga

DBGET integrated database retrieval system