KEGG   Synechocystis sp. IPPAS B-1465: C7I86_10335Help
Entry
C7I86_10335       CDS       T05368                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
syo  Synechocystis sp. IPPAS B-1465
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pox_ser-thr_kin Kdo
Motif
Other DBs
NCBI-ProteinID: AVP90031
LinkDB All DBs
Position
2182904..2184799
Genome map
AA seq 631 aa AA seqDB search
MESLPVLGVFFMVKTANVAVMPLFPRSQYRIIGQIGQGQFGRVYCAIHRTTGKMYALKDL
EHRVFPTNKFLRELSYLLTLRHPNIVACHGLEYHPGGRYLVMDYCEGGTLRDIIDGDGDL
CLAGKIDLLRQILLGLAQAHQHDIVHCDLKPENILLIPRAEGWQVKVSDFGIARLTAKTG
NPNFSKGYTGSPAYMAPERFYGKFSVASDIYAVGILLYELIVGDRPFSGFPKALQAAHLN
VRLTLPPEFPPLLAPIVQRALEKLPQRRFPNATAMASDLATVQKQILEQDPPRGNGYLYH
HLAPAPLAFTATVKHSTPLLFPISHLTGAGLWLYLGNGAELYLWEYGDGNVEHHPLPRWA
LGLPGTIANLEVNQDQISLLIQGGEPGEWQFYQWRETLLGALSLPKPRINLRAERLLANL
SPGGKTLAVVVGDRDSEKGHFQLWRTDHSLPVAAAVVIRWPDQLLTLDQNHGLLVQSQST
ASYCHTIFFLFNRRGSLFPAFRLSFLVFQLVVNRYSRNHLFGLADNAPYTGILIRLQPLK
VNRIALTIQPQFIEPFPWGYLLADRHGEVALLDYEGFLFGNFSLGETITAIAPMGRYLCL
FATWQGNGGTLRLLDLGPQVENIIRQRQEKR
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggaatcactccccgtcctaggcgtattttttatggtaaagactgccaatgtggcggtt
atgccgctgtttccccgctcccaatatagaatcattggacagatcggacagggacagttc
gggcgggtttactgtgctattcaccggactacgggcaaaatgtatgccctgaaggattta
gaacatcgggtatttcccactaataaatttctgcgggaactgtcctatctgttgaccctg
cgccatcccaacattgtggcttgccatggtttggagtaccatcctgggggccgctatttg
gtgatggattactgtgaggggggaactctgcgggacattattgatggggacggagattta
tgtttggcgggaaaaatagatttattaagacaaatattgctgggtttggcccaagcccat
cagcatgacattgtccactgtgaccttaaaccggaaaatatcctgttaataccccgggca
gagggatggcaggtaaaagtatcagattttggcattgctcgcctaacagctaaaacgggc
aatcctaatttcagcaagggttacactggttctcccgcctatatggccccggaacggttc
tacggcaagttttctgtagcttccgacatttatgctgtgggtattttgctgtacgagctc
atcgtcggcgatcgcccgttttcaggatttcctaaagcgttgcaggcagcccatctcaat
gtccgcttaaccttaccgccggaatttcctcccttacttgcccccattgtccaacgggct
ttggagaaattaccccaaagacgatttcccaatgccacagccatggccagtgatttggcc
acggttcaaaaacaaatattggaacaggatccccccaggggtaacggctatctttaccat
cacttggctccagctccgctagcctttacggccacagtcaaacacagtactcccttgtta
tttcccattagtcacctaactggggcaggactttggttatacctaggcaatggggccgaa
ctgtacctatgggagtatggcgatggaaatgtggagcaccatcctttgccccgctgggcg
ttgggtttaccgggaaccatagctaatctggaagtaaatcaagaccaaattagcctctta
atccagggaggtgaaccaggagaatggcaattttaccagtggcgagaaaccctacttggc
gctctctctctccccaaacctcgcattaatttgcgggcagagcgtctgttggccaatcta
agccccggtggtaaaactttggcagtggtagtaggcgatcgggacagtgaaaaaggccat
tttcaattatggcgcactgaccacagcttacctgtggctgcagccgtagtaattcgatgg
ccggatcaactgctcaccctagaccaaaaccatggcctgttggtgcagtctcaatcaacg
gcaagttattgtcatactatttttttcctgtttaatcggcgggggtccctgtttccagcc
tttcgcctttcttttttggtatttcaattggtagttaatcgctactcccgcaaccatctg
tttggcttggccgataatgctccctacactggtattttgattcgtctgcaacccctgaaa
gtcaatcgcattgccctaactatccagccccaattcattgagccttttccctggggttat
ctactagccgatcgccatggggaagtagctttgttggactatgaaggttttttatttggc
aatttttccctcggggaaaccatcacggcgatcgcccccatgggtcgctatctctgttta
tttgctacctggcagggcaatgggggaactttacgtcttctggatttgggtccccaagtg
gaaaacattattcgccaacgccaggaaaaacgctaa

DBGET integrated database retrieval system