KEGG   Synechocystis sp. IPPAS B-1465: C7I86_11635Help
Entry
C7I86_11635       CDS       T05368                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
syo  Synechocystis sp. IPPAS B-1465
Pathway
syo00630  Glyoxylate and dicarboxylate metabolism
syo00710  Carbon fixation in photosynthetic organisms
syo01100  Metabolic pathways
syo01120  Microbial metabolism in diverse environments
syo01200  Carbon metabolism
Module
syo_M00165  Reductive pentose phosphate cycle (Calvin cycle)
syo_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
syo_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    C7I86_11635
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    C7I86_11635
Enzymes [BR:syo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     C7I86_11635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AVP90256
LinkDB All DBs
Position
2481317..2481658
Genome map
AA seq 113 aa AA seqDB search
MKTLPKERRYETLSYLPPLTDQQIAKQVEFLLDQGFIPGVEFEEDPQPETHFWTMWKLPF
FGGATANEVLAEVRECRSENPNCYIRVIGFDNIKQCQTVSFIVHKPNQNQGRY
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttacccaaagagcgccgctacgaaaccctttcttacctgccccctttaacc
gatcaacagattgctaaacaggttgagtttctgttagaccagggctttattcccggcgtg
gaatttgaagaagacccccaacccgaaacccacttctggaccatgtggaaactgcccttc
tttggtggtgccactgccaacgaagttctagccgaagtacgggaatgtcgttctgagaat
cccaactgctacattcgggtgattggtttcgacaatatcaaacagtgccagactgtaagc
tttattgtccacaaacccaaccaaaaccaaggccgttactaa

DBGET integrated database retrieval system