KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0110
Entry
SYNPCC7002_A0110  CDS       T00664                                 

Definition
(GenBank) dihydrolipoamide S-acetyltransferase; 2-oxo acid dehydrogenases acyltransferase (catalytic domain)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syp  Synechococcus sp. PCC7002
Pathway
syp00010  Glycolysis / Gluconeogenesis
syp00020  Citrate cycle (TCA cycle)
syp00620  Pyruvate metabolism
syp01100  Metabolic pathways
syp01110  Biosynthesis of secondary metabolites
syp01120  Microbial metabolism in diverse environments
syp01200  Carbon metabolism
Module
syp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNPCC7002_A0110
   00020 Citrate cycle (TCA cycle)
    SYNPCC7002_A0110
   00620 Pyruvate metabolism
    SYNPCC7002_A0110
Enzymes [BR:syp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SYNPCC7002_A0110
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding PASTA
Other DBs
NCBI-ProteinID: ACA98125
CyanoBase: SYNPCC7002_A0110
CYORF: SYNPCC7002_A0110
UniProt: B1XLG5
LinkDB
Position
110430..111740
AA seq 436 aa
MIHDIFMPALSSTMTEGKIVSWTKSPGDKVAKGETVVVVESDKADMDVESFNEGFLAAII
VDAGEEAPVGSAIALIAETEAEIPEAKQKAATLKGGSSAPAANPAPAPAPAAPSPEPAPV
VAAPAPTPAAPTPAPVVNDGRIIASPRAKKLAKEFGVDLKTVPGSGPHGRIVAEDVEKAA
GKAPTIAPAAVSTPAPTTSKPAAPAPAPVAVTPGEVVPLNTLQQAVVRNMNASLNVPTFH
VSYDITTDALDALYKQIKSKGVTMTGLLAKAVAVTLQKHPVVNASFGDNAIQYSSGINVA
VAVAMPDGGLITPVLQNADQMDIYSLSRKWKDLVDRARLKQLQPDEYSTGTFTLSNLGMF
GVSSFDAILPPGQGSILAIGGAQPKVVATPDGLFGVKKQMTVNITCDHRIIYGADAAAFL
KDLADLIENNTHSLTL
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgattcacgatattttcatgcccgccctcagctctacgatgaccgaaggtaaaatcgtt
tcttggactaagtccccgggagataaagtcgctaaaggtgaaaccgttgtcgtggtggaa
tctgacaaagccgatatggacgttgagtcttttaacgaagggtttctcgcggcgattatc
gttgatgcaggggaagaggcaccagtgggttcggcgatcgccctcatcgctgaaaccgaa
gcagaaattccagaggccaaacaaaaagccgcgactctgaaagggggtagtagtgctcct
gctgctaatcctgcgcctgcacccgcccctgcggcacctagtccagaaccggctcccgtt
gtggcagccccggcgcctacacctgcggcaccgactcccgcaccagtggtcaacgatggc
agaattattgcttctccgagggcgaaaaaactcgccaaagaatttggtgttgatcttaaa
acagtgcctggttctggcccccacggtcgaattgtcgccgaagatgtcgaaaaagccgct
ggtaaagcacctactattgcccctgctgccgtatcaactccagcgccgacaaccagtaag
cctgccgccccagcgccagctcccgtcgctgtcactcctggtgaagttgtcccgctgaat
acgttgcaacaggcggttgtgcggaatatgaatgccagcctgaatgtacccaccttccat
gtgtcctatgacatcacgaccgatgccctagatgccctctacaagcaaattaagagtaag
ggcgtcaccatgacaggtctattggcgaaggccgtggctgtgaccctccagaaacatcca
gtagttaatgccagctttggggataatgcgatccaatacagcagtggtattaatgtggcg
gtggccgttgcgatgcccgacggcggcctgattacccctgtgctgcaaaatgccgatcaa
atggatatctattccctttcccgcaagtggaaagatttggtagaccgggcgcgcctcaag
caactgcagcccgatgagtacagcactggcacctttaccctctctaacctagggatgttt
ggggtcagcagttttgatgcgattttgccccctggtcaaggttctattttggcgattggg
ggtgctcaacctaaagtcgttgcgacgcccgacggtttatttggtgtgaaaaaacaaatg
accgtcaatatcacctgcgaccaccgcattatttatggtgccgatgcggcagcattcctt
aaggatttagctgacttgattgaaaataacacgcacagtctgaccctttag

DBGET integrated database retrieval system