KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0242Help
Entry
SYNPCC7002_A0242  CDS       T00664                                 

Gene name
sodB
Definition
(GenBank) Mn-superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
syp  Synechococcus sp. PCC7002
Brite
Enzymes [BR:syp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SYNPCC7002_A0242 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACA98253
CyanoBase: SYNPCC7002_A0242
CYORF: SYNPCC7002_A0242
UniProt: B1XMR6
LinkDB All DBs
Position
252228..252827
Genome map
AA seq 199 aa AA seqDB search
MGYELPSLPYDYTALEPHISKSTLEFHHDKHHASYVSKYNDAVAGTDMDSKSIEDVIKAV
AADPAKAGLFNNAAQAWNHSFYWNCMKPGGGGQPTGALADKINADFGSFDKFVEAFKTAG
GTQFGSGWAWLVLDNGTLKVTKTGNAGNPMTEGQTPLLTMDVWEHAYYLDYQNRRPDYIN
TFLTSLVNWDFVAANLAAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgggatacgaactaccttcattaccctacgattacactgccctcgaaccccacatctcg
aagagcaccttagaatttcaccacgataagcaccatgcgagctacgtctccaagtacaac
gatgccgtagctggcaccgacatggatagcaaaagtatcgaagacgtaatcaaagccgta
gctgcagatcccgccaaagcaggtttgtttaataacgctgcccaagcgtggaaccacagc
ttctactggaactgcatgaagcccggtggcggtggtcaacccactggtgccctcgccgac
aaaatcaacgccgacttcggtagttttgataaattcgttgaggctttcaaaaccgctggt
ggcacccagtttggtagtggttgggcttggctcgtcctcgacaatggcaccctcaaggtc
actaaaaccggcaatgctggcaaccccatgaccgaaggccaaactcccctcctcaccatg
gacgtttgggaacacgcctactacctcgactaccaaaaccgtcgccccgactacatcaac
accttcctcaccagtcttgtgaattgggatttcgtggcggctaacctcgcagcggcctaa

DBGET integrated database retrieval system