KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0534Help
Entry
SYNPCC7002_A0534  CDS       T00664                                 

Definition
(GenBank) transporter, major facilitator superfamily
Organism
syp  Synechococcus sp. PCC7002
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like MFS_3 OATP
Motif
Other DBs
NCBI-ProteinID: ACA98541
CyanoBase: SYNPCC7002_A0534
CYORF: SYNPCC7002_A0534
UniProt: B1XPI4
LinkDB All DBs
Position
complement(565967..567199)
Genome map
AA seq 410 aa AA seqDB search
MGNASKTWLLGLDRQIWILAAGRLLSQIGTGFTAFYAPIFFVNQVGLSATQVGLALGSAS
VSGVVGRFLGGTGADNPAWGRKKTLLAAAGVSAIADVALATADTFWLLVLGNLLMGLGIG
LYWPATETVVADLTSGSQRNEAFALVRLADNIGLGTGVMLGGLIIATIQNYRLLFVLDGI
SFVVFFGVIWVAIAETYQSHEDVQADGNSWLTALQDQRLVIYMAVNVMFTLYIAQIQSTA
PLYLTNFIEFSPQVISGLFAWHIVFASVCQLPIARRLNGLSRPHALMVSLLLWGMGFTVM
WGAGIGAIPALVGAIASLGILALATDAYTPAASALVVDLAPASQRGVYLALNSQCWAIGY
LIGPPIGGWALDQVPAIAHGFWLAGAVSIVPCLLTLRYLETLITHKKTEG
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatgcatcaaaaacttggctgctgggccttgatcgccagatctggatcctcgca
gcaggccgacttctttcccagattggcaccgggttcactgccttttatgcgccaatcttt
ttcgtaaatcaggtgggcctatcagcaacccaggtgggcctcgcgttagggagtgcctcg
gtttcgggggttgtgggccgttttttagggggaacaggggcggataatccagcctgggga
cgcaaaaaaacgctgctggccgccgcaggggtttcggcgatcgccgatgtggctttagca
acggcagatacgttttggctgttggtgctgggaaatttgttaatgggcttggggatcggt
ttgtattggcctgcgacagaaacggtggtggcagatttaaccagcggtagtcagcgtaat
gaagcctttgccttggtgcgcctggcggacaacattggcctcggtacaggggtgatgctg
gggggcttgatcattgcaacgattcaaaattatcgtttgctgtttgtcctcgatggcatc
agttttgtggtgttttttggggtgatctgggtggcgatcgccgaaacctaccaaagccac
gaagatgtccaagcggatggtaatagctggttaacggccctccaggatcaacggctggta
atttatatggccgtcaatgtgatgtttacgctgtacatcgcccagatccaaagcaccgcg
cctttatacctcacgaatttcattgaattttcgccccaggtgattagtggcctgtttgcc
tggcatatcgtgtttgcttccgtctgtcagttgcccattgcccggcgtttaaatggcttg
agccgaccccatgccctgatggtttccctcctgttatggggcatgggctttacggtgatg
tggggagcgggtattggtgcaattccggccctggtgggggcgatcgccagtctggggatt
ttagccctagccaccgatgcctataccccagccgcttctgctttagtggttgatctcgcc
ccagcctcccaacggggtgtttacctcgcactgaattcccaatgttgggcgattggttat
ttaattgggccaccgatcggcggttgggccttggatcaggtgccggcgatcgcccatgga
ttttggctggcgggggcagtgagtattgttccttgtctgttgaccttgcggtacctcgaa
acccttatcacccacaaaaaaacggagggttaa

DBGET integrated database retrieval system