KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A1919Help
Entry
SYNPCC7002_A1919  CDS       T00664                                 

Gene name
proC
Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
syp  Synechococcus sp. PCC7002
Pathway
syp00330  Arginine and proline metabolism
syp01100  Metabolic pathways
syp01110  Biosynthesis of secondary metabolites
syp01130  Biosynthesis of antibiotics
syp01230  Biosynthesis of amino acids
Module
syp_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:syp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SYNPCC7002_A1919 (proC)
Enzymes [BR:syp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     SYNPCC7002_A1919 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored Glt_symporter NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ACA99906
CyanoBase: SYNPCC7002_A1919
CYORF: SYNPCC7002_A1919
UniProt: B1XQL1
LinkDB All DBs
Position
2002223..2003032
Genome map
AA seq 269 aa AA seqDB search
MAAKFGMIGGGVMGEALLARLLKEQIYLPADVIVSEPVAERRAYLQQEYQVGVTASNQEA
AIASEVLMLAIKPQIFNQVSTELQGQQLETPPLVLSILAGVTLAQLQGGFRDYPVVRAMP
NTPAIIGQGMTAITPGDRVSEAQVALAKRIFGAVGEVVAVPESLMDAVTGLSGSGPAFVA
LMVEALADGGVAAGLPRATAQQLALQTVKGTAELLQTSGLHPAQLKDRVTSPGGTTIAGV
AALEAHGFRSGVIAAVTAAKARSVELGQG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaaaattcggcatgattggcggcggtgtcatgggagaggccctcctcgcacgg
ctcctcaaggaacaaatttacttgccagcagatgtgattgtgagtgaacctgtggcggaa
cggcgggcttatttacaacaggaatatcaagtgggtgtcacggccagtaaccaggaagcg
gcgatcgcctctgaagttttaatgttggcaatcaagccacaaatttttaatcaagtcagc
accgaactccaaggtcaacagctagaaacgcctcccctggtgttgtcaatcctcgctggg
gttaccctggctcagttacaaggcggttttagggactatccagtggtgcgggcaatgcca
aatacaccggcgattattggccaagggatgacggcgatcacccctggggatcgcgtttca
gaagcccaggtcgccctcgcaaaacgaatttttggggctgtgggtgaagtggtggcagta
ccagagtctctgatggatgcggtgactggactttctggctctggcccggcttttgtggcc
ttgatggtagaagccctggccgatggcggcgttgcggcaggtttgccccgggccacggcc
caacaactcgccctccaaacggtcaagggaacggcggaattactccaaacctccggctta
catcccgctcaactcaaagaccgggtgaccagtccagggggcactaccattgctggtgtt
gcggcccttgaagcccatgggtttcgctcaggggtcattgctgctgttaccgcggcgaag
gcccgttctgtcgagttgggccaaggatga

DBGET integrated database retrieval system