KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A1977Help
Entry
SYNPCC7002_A1977  CDS       T00664                                 

Definition
(GenBank) AMP-binding enzyme
Organism
syp  Synechococcus sp. PCC7002
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: ACA99964
CyanoBase: SYNPCC7002_A1977
CYORF: SYNPCC7002_A1977
UniProt: B1XHP6
LinkDB All DBs
Position
complement(2059517..2061295)
Genome map
AA seq 592 aa AA seqDB search
MTHSAKTIVDLLRHRADSTPDRTAYHFISGEDNLTTLTYAQLEHQVKAIAAHLQTFIEPG
DRILLVFPYSAGLEFVASFYACLYAGAIAVTINPSRSDDALEKLMERVEDCQAKGILTTR
ALIDYFQKKLTKAPRQAAGLVRKFSQVKVIAMDEIPADLAADWQAPKITDDTLAFLQYTS
GSTGKPKGVMVTHGNVLHNSAVIYKSFSHSPETRMASWLPMFHDMGLIGGVLQPFYGNFE
AFLMSPIELVQKPVRWLEIISQHRITTSGGPNFAYDLVARQVTPEQLKTLDLNSWDVAYS
GAETVRASTLEKFTQTFAPCGFRREAFYPCYGMAEATLFISGGSKEKAPVVQYMAPEALE
QNQAIISTDGSRGIVSCGWTWLDDEVIIVDPETKTKLPEGQVGEIWAAGKGIGKGYWEQP
EITKETFQAYVDNQGPYLRTGDLGFLKDGELFITGRTKDVMILWGRYRYPQDIELTVEQC
HPALRPCAGAAFSVEAADEERLVVVQELERSYVRKFDLEEIVGAVRQAVYEEHTVEVYGI
VLLRTGNIPKTSSGKIQRQACRQQYLAGTLNGLGEWQLAIADSDVTALANSL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgacccattctgcgaaaaccattgttgatctgcttcgtcaccgcgctgacagcaccccc
gaccgcaccgcctatcactttatttcaggcgaagataacctcacaaccctgacctatgcc
caactagagcaccaggtaaaggcgatcgccgcccatttgcaaacctttatcgaaccaggc
gatcgcattttgttagtgttcccctactcggcgggcctcgaattcgtcgctagtttttac
gcttgtctctacgccggggcgatcgccgtcaccattaaccccagtcgcagtgatgacgcc
ctcgaaaagcttatggaaagggtagaagattgtcaggccaagggaatcctcacaacccgc
gccctcattgactatttccaaaagaaactcactaaagccccccgccaggccgctggtctt
gtgcgcaaatttagccaagtcaaagtaattgcgatggatgaaattcccgcagatctcgca
gcagactggcaagcccccaagattaccgacgacaccctcgcctttttgcaatacacctcc
ggctccacagggaaacccaaaggcgtgatggtcacccatggtaatgtgctccataactcc
gccgtgatttacaaatcctttagccacagtcccgaaacccggatggccagttggctcccc
atgtttcacgatatgggcttgattggcggcgtcctccagcctttttatggcaactttgag
gcctttctgatgtctcccatcgagctagtacaaaagcccgtccggtggctagagatcatc
tcccagcaccgcatcaccaccagtggtggcccgaactttgcctatgatctggttgctcgc
caagtcaccccagaacaactcaaaaccctcgatctcaactcttgggatgtggcctatagt
ggcgctgaaactgtccgggctagtaccctagaaaaattcacccagaccttcgccccctgt
gggtttcgtcgcgaagccttttatccttgctatggcatggccgaagcgactctgttcatc
agtggtggctccaaggaaaaagcgccagtggtgcaatatatggcccccgaagccctcgaa
caaaatcaagcgatcatcagtaccgatggcagtcggggtattgttagttgtggctggaca
tggcttgacgatgaagtaattatcgttgacccggaaaccaaaaccaagcttcccgaaggc
caagtgggcgaaatttgggccgcaggcaaaggcattggtaaaggctactgggagcagcca
gaaatcacaaaagaaaccttccaagcctatgtggataaccaaggcccctatctccgcaca
ggggatctcggctttttaaaagatggtgaactctttattaccggacgtacgaaggacgta
atgattctttggggccgctaccgttatccccaggacattgaactgactgtggagcaatgt
cacccggctctgcgtccctgtgcgggtgcggctttttccgttgaggccgccgatgaagaa
cgactggtggtggttcaagaattggaacggagctatgtccgtaaatttgatctagaggaa
attgttggggcagttcgccaggctgtgtacgaggaacatacggtggaagtttacggtatt
gtcctcttgcgaacgggcaatatccccaagacctccagcggtaagattcaacggcaagcc
tgtcgtcagcaatatctggcgggtaccctcaacggtttgggggaatggcagttggcgatc
gccgatagtgatgtcacggccctggccaatagcctctaa

DBGET integrated database retrieval system