KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A1979Help
Entry
SYNPCC7002_A1979  CDS       T00664                                 

Definition
(GenBank) AMP-binding enzyme
Organism
syp  Synechococcus sp. PCC7002
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Aminotran_1_2 PP-binding Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ACA99966
CyanoBase: SYNPCC7002_A1979
CYORF: SYNPCC7002_A1979
UniProt: B1XHP8
LinkDB All DBs
Position
complement(2062148..2065441)
Genome map
AA seq 1097 aa AA seqDB search
MIYCFMTFLQHSIQAQASLLDILNERARSQPNAQAYVFLENGETESGHLTYQELATQAKA
IASHLTPWRGERALLLYPSGLAFITAFLGCLYAGVIAVPVYPPKRNQKLSRLLAIADNAQ
AELALTTEALLGDIQQRFAQAEQFQDLTFLATDTLKQAPQGFKPQTIQGDDLAFLQYTSG
STGTPKGVMVSHRNILHNQRLIQTAFGHSEKSIGVGWLPLFHDMGLIGHVLQPLYVGFPS
ILMPPVAFLTNPRRWLQAIAKYRATTSGGPNFAYDLCVDRLTDSDLADLDLSSWNLAYSG
AEPVRAATLEKFNQKFAPCGFRPEAFYPCYGMAEATLFITGGDKQQAPITTSSSEESDNL
FVSCGQPYHDTQVAIVDPESFAPCPEGTTGEVWVRGDSVARGYWNAPIATQETFTATLNH
HQKSFLRTGDLGFIAAGELFITGRLKDLIIVRGKNHYPHDIELTAQQSHPALRENCGAAF
TVEIDGTERLMLVQEVKRTFLRNLDVEAIAQKIRQTIAANHELQTYGIILIKTGSIPKTS
SGKIQRHRCRQAFLADELMVVGRSVLGEVDHASAQSFNPPQKQQPSQPTTDLIKPLREQL
AQALSLPLDTIQDDQPIAALGLDSVQVVEIKHYIEQKFDLIVPLEKFFEDLTVAQLAQDI
LTLANLPQESQHHQNGHLPQATQLEAEGIDLDQRLRLAYKPSRNVLDKAREFNLPDQLRA
NDLLPYFRALERNEGATCIFEGRQLIMLGSNNYLGLTADVRVREATAKAALEEGPSLTGS
RLLNGSTRQHREFERKLAAFVGHEDALVFTTGYQANLGFISALMNENTTMILDSEAHACI
YDGAFMSRCRVVQYQHNDLQDLEQKLIQVTPESATMVTIDGLYSMTGDIAPLPEIRQLCD
RHGATLAVDDAHALGVLGKTGRGTEEHFGMIDSSDILCGTFSKSLASIGGWVAAEAKVID
WIRFNGRSMLFSASIPPTSLAAAATALDILIAEPWRVQKLHENAQYWQRGLQSLGFTVGT
AQTPIITVHIGDDFKCMQFCKALLEAGVYVNAAVYPAVPRNKAALRTSVMATHTQEHLDK
ALAIFAEVGQQFLAGAE
NT seq 3294 nt NT seq  +upstreamnt  +downstreamnt
ttgatttactgctttatgacgtttctccagcattctatccaggcacaagcatcgttgctc
gatatcctcaatgagcgggcacgcagccaacccaatgcccaagcctatgtttttttagaa
aatggagaaactgaatctggtcacctcacttaccaagaattagcgacccaggcgaaggcg
atcgcctcccatctgaccccctggcgtggggaacgggcattgttactgtatccgtctgga
ttggcgtttatcacagcatttttggggtgtctttatgccggggtgattgcggtgcctgtc
tatccgccgaagcgcaaccaaaagttatcgcgcctgttggcgatcgccgataatgcccag
gccgaacttgccctaaccaccgaggctttgttaggagatattcaacaaagatttgcccaa
gcagagcagtttcaggatttaacctttttggcgacggatactttaaaacaagctccccaa
ggcttcaagccccagacaattcagggggatgatctagcatttctgcaatacacttctggc
tctacggggacacccaagggcgtgatggtttcccaccggaatatcctccacaaccagcga
ctgattcaaaccgcctttggccatagtgaaaagagtatcggggtcggttggctgcccctt
ttccatgatatgggtctcattggccatgtactccagccgctttacgtgggctttcccagt
attttgatgcctccggtggcgtttttgacaaatccccgccgctggctccaggcgatcgcc
aaatatcgggctacgaccagcggtgggccaaattttgcctatgatctgtgtgttgatcgc
ctgacggacagtgatctagccgatctagatttaagcagttggaatcttgcctacagtggt
gcggaaccagtgcgggcggcgaccctcgaaaaattcaatcaaaaatttgccccctgtggt
ttccggccagaggccttttatccctgctatggcatggcggaggcgaccctattcattacg
gggggtgataagcaacaagccccgatcaccaccagttcgtccgaagagtcagacaattta
tttgttagttgtggccaaccctaccatgacacccaggtggcgatcgtcgatccggagtct
tttgccccttgtcctgaagggacgactggggaagtgtgggtgcggggggacagtgtcgcc
cggggttattggaatgcccccattgccacccaggaaacctttacggcaactctcaatcac
catcaaaaatctttcctgcgcactggtgatcttggttttatcgccgcaggagaactgttc
attaccggtcgccttaaggatttaattatcgtccgaggaaaaaatcactatccccacgac
atcgagcttacggctcaacagtctcacccagctctccgggaaaattgcggggcggccttc
acggtagaaattgacggtacagaacgcctaatgctggtgcaagaggtaaaacgaaccttt
ctccgaaatctggatgtcgaggcgatcgcccaaaaaatccgtcaaacgatcgcggcaaac
catgaactacaaacctatggcatcatcctgattaaaaccggtagtatcccgaaaacgtcc
agcggtaaaatccaacgacaccgttgccgtcaggcgtttctggccgatgagttgatggtt
gtgggccgcagcgtcctgggtgaagtagatcatgcttccgcccaaagttttaatcctccc
cagaaacaacaaccctcccagccgaccactgacttaattaaacccctccgcgaacaattg
gcccaagccctctcgttgccccttgataccatccaagacgatcagcccatcgccgctttg
ggcctagattccgtgcaagttgttgaaatcaagcattacatcgagcaaaaattcgactta
atagtgccccttgaaaaattttttgaggatcttaccgttgcccaactcgcccaagatatc
ctgactctagctaatctcccccaagaatcccaacatcaccaaaacggacatctcccccaa
gcgactcagctagaagcagagggcatcgatctcgaccaacggttgcgcctcgcttataaa
ccaagccgcaatgtcctcgataaagccagggagtttaacctgccggatcaattgcgagct
aatgatctactgccctatttccgtgcccttgaacgcaatgaaggggccacctgtattttt
gaagggcgacaactaattatgttgggctccaataattatctggggctgactgccgatgtc
cgagtacgagaagccactgccaaggccgctctagaagaagggccgagtttaacgggatca
cgattgctcaatggttcgacccgccaacaccgagaatttgagcgaaaacttgccgccttc
gtcggtcatgaggatgctctagtctttaccacgggatatcaagcgaatttaggctttatt
tccgccttaatgaacgaaaatacaacgatgatcctcgacagtgaggcccatgcttgcatt
tacgatggggcgtttatgagtcgctgccgggtagttcaataccagcacaatgacctgcaa
gatttagaacaaaaattgatccaggtgacgccagagtccgcaacaatggtcacgattgat
ggtctgtattcaatgacgggggatattgcgcccctaccagaaattcggcaattatgcgat
cgccatggggctaccctcgcagtagatgatgcccatgctctgggtgttttgggaaaaacg
ggccgggggacggaggagcatttcgggatgatcgacagcagtgatattctttgtggcact
ttttccaagagtttggcttccattggcggttgggtcgccgccgaagcaaaggtgattgat
tggattcgttttaacgggcggtctatgttattttctgcttctattccgcctacttccctg
gctgcggctgccacggccttggatattttgatcgccgagccctggcgggtacaaaagctc
cacgaaaatgcccaatattggcaacgggggttacagtcccttggctttacggtcggtacc
gcccaaacgccgattattacggtacacattggcgatgattttaaatgtatgcagttctgt
aaggccctactagaggcaggagtttatgtgaatgcagcggtgtatccggcggtgcctcgt
aataaagccgccctccggaccagtgtgatggcgacccacacccaggaacatttagacaaa
gccctcgcaatttttgcggaagtcggtcagcaatttctggctggggctgaatag

DBGET integrated database retrieval system