KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A2536Help
Entry
SYNPCC7002_A2536  CDS       T00664                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
syp  Synechococcus sp. PCC7002
Pathway
syp00970  Aminoacyl-tRNA biosynthesis
syp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SYNPCC7002_A2536 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:syp03029]
    SYNPCC7002_A2536 (gatB)
Enzymes [BR:syp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SYNPCC7002_A2536 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SYNPCC7002_A2536 (gatB)
Mitochondrial biogenesis [BR:syp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SYNPCC7002_A2536 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Aconitase_B_N zf-Di19
Motif
Other DBs
NCBI-ProteinID: ACB00513
CyanoBase: SYNPCC7002_A2536
CYORF: SYNPCC7002_A2536
UniProt: B1XKN8
LinkDB All DBs
Position
complement(2641251..2642741)
Genome map
AA seq 496 aa AA seqDB search
MAVAAPRKTEYEAIIGLETHCQLNTASKIFCHCSTKFDSDPNSNVCPVCLGYPGVLPVLN
EKVLESAVKMGLALKAKISPYSKFDRKQYFYPDLPKNYQISQFDLPIVEHGHLEIEIADK
PSDPPVKKTIGVTRLHMEEDAGKLVHAGSDRLAGSTYSKVDFNRTGIPLLEIVSEPDIRS
GKEAAEYAQELRRLVRYLGIGDGNMQEGSLRCDVNISIRPVGQEEFGTKVEIKNMNSFSA
IQKAIDYEIERQIKAVETGEPIYQETRLWDESSQRTFSMRKKEGSSDYRYFPEPDLPPIE
VTPAQLEKWAAELPETPAQKRERYETEYGLSSYDTRVLTDDRDVAEYFEAAVAAGADPKQ
VTNWVTQDIAAHLNKNVGLTIVELPLKATQLAELVNLIHDGTISGKIAKEILPELLEQGG
SPKAIVESRGLTQISDTGALEAMVDEVLAANPEKVEQFRAGKTKLQGFFVGQLMKKTSGR
ADPKLLNQILAQKLRG
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcagttgcagcaccccgcaaaaccgagtatgaagcgattattgggctcgaaacccat
tgtcagctcaataccgccagcaaaattttttgtcattgttctactaaatttgacagcgac
cccaacagcaatgtctgtcccgtctgcctaggctatcctggagttttgcccgttttaaac
gaaaaggtgctggaatcggcggtgaaaatgggcctggccctcaaggcaaaaatcagcccc
tacagcaaatttgaccggaaacaatatttttacccagacctacccaaaaattaccaaatc
tcccaattcgatctgcccattgttgagcatggtcacctagaaattgaaatcgccgacaaa
cccagtgacccccccgtcaaaaaaaccattggcgtgacccgcctccacatggaagaagac
gccggaaaattagtccatgccgggagcgatcgcctcgcgggttctacctactctaaagtg
gatttcaatcgtaccgggattccgctcctggagattgtctcagaacccgatattcgttct
ggcaaagaagccgctgaatatgcccaggaattgcgccgcctcgtccgctatctcggcatc
ggcgatggcaacatgcaagaaggctctctccgctgtgacgtaaatatttccattcgtcct
gtcggccaagaagaattcggcaccaaagtcgaaatcaaaaatatgaactctttcagtgcg
atccaaaaggcgatcgactacgaaatcgagcgacaaatcaaagccgtcgaaacaggggaa
cccatctaccaagaaacgcgcctctgggatgaaagtagccagcgcacctttagtatgcgg
aaaaaagaaggctccagcgattaccgttattttccagagccagacctgccccccattgaa
gtgaccccagcacaactagaaaaatgggctgccgaactccccgaaacccccgcccaaaaa
cgagagcgctacgaaaccgagtatggtctgtcttcctatgacacgagggttttaaccgac
gaccgcgacgtagccgaatactttgaagcggctgtggcggctggggcagatccgaaacaa
gtaaccaactgggtgacccaagacatcgctgcccacctgaataaaaatgtcggtctaacg
attgttgagcttcccctaaaggcaacgcaattagccgaactcgtcaatttaattcacgat
ggcaccattagcggcaaaattgccaaagaaattctcccggaactgttagagcaaggcggt
tcgcccaaggcaattgttgagagtcgcggcttgacccaaatttcagacacaggtgctcta
gaggccatggtggatgaagttttggccgccaatcctgagaaggtagaacaattccgcgcc
ggaaaaacaaagctacagggcttttttgtggggcaactgatgaaaaaaaccagcggccgt
gctgatccgaaactgctcaaccaaatcctggcccagaaactgcggggctag

DBGET integrated database retrieval system