KEGG   Synechocystis sp. PCC 6803 PCC-P: SYNPCCP_1023Help
Entry
SYNPCCP_1023      CDS       T01891                                 

Gene name
gatA
Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
syq  Synechocystis sp. PCC 6803 PCC-P
Pathway
syq00970  Aminoacyl-tRNA biosynthesis
syq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SYNPCCP_1023 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:syq03029]
    SYNPCCP_1023 (gatA)
Enzymes [BR:syq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SYNPCCP_1023 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SYNPCCP_1023 (gatA)
Mitochondrial biogenesis [BR:syq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SYNPCCP_1023 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase DUF3194
Motif
Other DBs
NCBI-ProteinID: BAL35109
LinkDB All DBs
Position
1135971..1137422
Genome map
AA seq 483 aa AA seqDB search
MSLIRALHQQLIDQEISAVAVAQASLARIEAVDDRLKSFLQVTAPQAIAQAEKVDAQIAA
GEPIGLLAGIPIGIKDNLCTKGIVTTCASQILRGFVPPYESTVTEKLQKAGAVMVGKTNL
DEFAMGSSTENSGYQVTANPWDLTRVPGGSSGGSAAAVAADECLIALGSDTGGSIRQPAS
LCGVVGMKPTYGLVSRFGLVAYASSLDQIGPFARRVEDAAILLQAIAGHDSRDSTSLDVP
IPDYTQALKPDLKGVKVGVIMDAFGEGLDDTVNEAVQTAIAKLRELGATIEEIHCPRFRS
GIAAYYVIAPSEASANLARYDAVRYGLRAEADNLMEMYTHTRAKGFGAEVKRRIMLGTYA
LSAGYYDAYYLKAQKVRTLIKQDFDQAFTKVDVLVCPTAPTTAFKAGEKTDDPLSMYLSD
LMTIPVNLAGLPAMSVPCGFDDNNLPIGLQLVGNVLGEEMLFRVGYAYEQATTWHDRQPD
LSA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttattcgtgccctgcaccaacaattaatagatcaagaaatttccgctgttgcc
gtggcccaggcgagtttggcgcggattgaagcggtggacgacagattgaaaagctttttg
caggtgacagctccccaggcgatcgcccaggcggaaaaggttgacgcccagattgcagcg
ggggaacccattggtctactggcaggcattcccattggcattaaagataacctttgcacc
aagggcattgttaccacctgtgcttcccaaattttgcggggttttgtgcctccctacgag
tccacagtgacggagaagttgcaaaaagccggggcggtcatggtgggcaaaactaaccta
gatgaatttgccatgggcagttccacggaaaattccggttaccaagtgacggctaatcct
tgggatttaaccagggtgccagggggatcttctgggggatcggcggcggccgtagcagcg
gatgaatgtttgattgctttggggtctgacacggggggctccattcgtcagcctgcttcc
ctctgtggggtggtgggcatgaaacccacctatggtttagtgtcccgttttggtttggtg
gcctatgcttcctctttggatcaaattggtccctttgcccgccgggtagaagatgcggcc
attctgctccaggcgatcgccggccatgatagtagggattccaccagcctagatgtgccc
attccggattacacccaagccctgaagccagatttgaagggagtgaaagtgggggtaatt
atggatgcctttggggaaggtttagacgatacggtcaatgaagcagtgcaaacggcgatc
gccaaactgcgggaattaggagccaccattgaggaaatccattgtccccggttccgttcc
ggtattgcggcctattatgtcattgccccttccgaagcgtcagctaacctggcccgttac
gatgcggtgcgctatgggctgcgggcggaagcggataatctgatggaaatgtacacccac
accagagccaagggttttggcgcagaagtgaaacggcgcattatgctcggcacctatgct
ctgtccgccggttactacgatgcctattacctcaaagcccaaaaggtgagaaccctgatt
aaacaagactttgatcaagcctttaccaaagtggacgtgttggtttgccccactgccccc
actacggccttcaaagcgggggaaaaaaccgatgatcccctcagcatgtatctctccgat
ttgatgaccattccagttaacttagctggtttaccggccatgagtgtgccctgtggcttt
gacgacaataatttacccattggcctgcaattggtgggcaatgtgttaggggaagaaatg
ctattccgggtgggctatgcctatgaacaagccaccacatggcacgatcgccaaccggat
ttatcggcctaa

DBGET integrated database retrieval system