KEGG   Synechocystis sp. PCC 6803 PCC-P: SYNPCCP_2041Help
Entry
SYNPCCP_2041      CDS       T01891                                 

Gene name
odhB
Definition
(GenBank) dihydrolipoamide acetyltransferase component(E2) of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syq  Synechocystis sp. PCC 6803 PCC-P
Pathway
syq00010  Glycolysis / Gluconeogenesis
syq00020  Citrate cycle (TCA cycle)
syq00620  Pyruvate metabolism
syq01100  Metabolic pathways
syq01110  Biosynthesis of secondary metabolites
syq01120  Microbial metabolism in diverse environments
syq01130  Biosynthesis of antibiotics
syq01200  Carbon metabolism
Module
syq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNPCCP_2041 (odhB)
   00020 Citrate cycle (TCA cycle)
    SYNPCCP_2041 (odhB)
   00620 Pyruvate metabolism
    SYNPCCP_2041 (odhB)
Enzymes [BR:syq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SYNPCCP_2041 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase PASTA
Motif
Other DBs
NCBI-ProteinID: BAL36127
LinkDB All DBs
Position
complement(2249483..2250784)
Genome map
AA seq 433 aa AA seqDB search
MIYDIFMPALSSTMTEGKIVSWTKSPGDKVEKGETVLVVESDKADMDVESFNEGYLAAIL
VPAGEEAPVGATLGLVVETEAEIAEAQAKAGSGGGSSAAPTATPAPQQPEPVAIASATAI
ETTPAPSSNGNGKGSGRIIASPRAKKLAKELKVDLATIAGTGPHGRIVAADIESAAGKPV
TASIAAPSAPAPKTSPAPTPRVTSTPSVPVGQTVPLTTFQKALVQNMVAAMAAPTFRVGY
TITTDGLDQLYKQIKGKGVTMTALLAKAVALALKKHPIVNASYTDQGIIYHKDVNIALAV
AMPDGGLITPVLQNADQVDIYSLSRRWKELVERARAKQLQPEEYSTGTFTISNLGMFGVD
RFDAILPPGQGGILAVGASRPQVVANEEGLIGTKRQMAVNVTCDHRVIYGAHAAAFLKDL
AVIIEENAQSLTM
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgacattttcatgcccgccctgagttccaccatgaccgaggggaaaattgtt
tcttggactaagtcccccggcgacaaagtggaaaaaggtgaaactgtcttggtggtggaa
tcggacaaagcagatatggacgtggagtcctttaacgaaggttacctagccgccattcta
gttccagcaggggaagaagctcccgtgggggcaacccttggcctagtggtggaaacggaa
gcggaaattgccgaagcccaagctaaagctggctctggtggtggttctagtgcggctccg
actgcaaccccagccccccaacaacctgaaccagtggcgatcgccagtgcaactgccata
gagacaactccggcccctagcagtaacggcaatggcaaaggcagtgggcgaattattgct
tccccccgggcgaaaaaactagccaaagagttaaaagttgatttagctaccattgctggc
actggcccccacggcagaattgtggccgcagatattgaaagtgccgctggtaaacccgtc
actgcttccatcgctgcccccagtgccccagctcctaaaacatcccctgcccctactcca
agggtaacctctacccccagtgttcccgtcggccagacagtacccctgaccactttccaa
aaagctttggtgcaaaatatggtggccgccatggccgctcctacattccgagtgggctac
accatcaccaccgatggactggatcaactttataaacaaatcaaaggcaaaggggtgact
atgacggccctgttggctaaagctgtggctctggccttgaaaaaacatcccattgtcaac
gccagctacactgaccaaggcatcatctaccacaaggatgtcaacattgctctggccgta
gccatgcccgatggcggtttaattactccggtgttgcaaaatgcagaccaagtagatatc
tactccctctcccgccgatggaaagaattggtggaacgggcccgggctaagcagttacag
cctgaagaatacagcactggcactttcactatttctaacctgggtatgtttggggtagac
cgatttgatgccattctaccgccgggtcaagggggaattttagcggtgggtgcttcccgt
ccccaagtagtggccaatgaggaaggtttgattggtaccaaacgacaaatggcggttaat
gtaacctgtgaccatcgggtaatttatggggcccatgccgccgctttcctgaaggatttg
gctgtcattattgaagagaatgcccagtctttgactatgtaa

DBGET integrated database retrieval system