KEGG   Synechococcus sp. RCC307: SynRCC307_1794Help
Entry
SynRCC307_1794    CDS       T00523                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syr  Synechococcus sp. RCC307
Pathway
syr00010  Glycolysis / Gluconeogenesis
syr00020  Citrate cycle (TCA cycle)
syr00620  Pyruvate metabolism
syr01100  Metabolic pathways
syr01110  Biosynthesis of secondary metabolites
syr01120  Microbial metabolism in diverse environments
syr01130  Biosynthesis of antibiotics
syr01200  Carbon metabolism
Module
syr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SynRCC307_1794 (pdhC)
   00020 Citrate cycle (TCA cycle)
    SynRCC307_1794 (pdhC)
   00620 Pyruvate metabolism
    SynRCC307_1794 (pdhC)
Enzymes [BR:syr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SynRCC307_1794 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CAK28697
CyanoBase: SynRCC307_1794
CYORF: SynRCC307_1794
UniProt: A5GUY8
LinkDB All DBs
Position
complement(1559215..1560549)
Genome map
AA seq 444 aa AA seqDB search
MATFEIFMPALSSTMTEGKIVEWLKQPGDRVERGESVLVVESDKADMDVESFEAGFLGAV
LLPAGGTAPVGETIGLVVETEAELAELKANGPAKPAASAPAAAPAPAPAAAPPAAPEPAP
APTPAPVAVAAPPAPASSNGHGGRVVASPRAKKLAQQLGVQLEGLRGSGPHGRLIAADIE
RAAGRTPTAPAAVPAGTLTAAQAAAPAVAPLPAAVAAPVAPGETLPFTTLQQAVNRNMVA
SLAVPTFRVGYTITTDKLDAFYKQVKPKGVTMTALLAKAVASALAGHPRVNAAFSEAGIA
YPEGINVAVAVAMEDGGLVTPVLAAADRNDLYSLSRSWADLVSRARSKQLKPEEYSTGTF
TLSNLGMFGVDRFDAILPPGTGAILAVGASRPVVAANSDGSIAVKRQMQVNLTADHRVIY
GADAAGFLKDLAKIIETQPESLAL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcgacattcgagatcttcatgccagccctcagctcaacgatgactgaggggaagatc
gttgagtggctcaagcagcccggcgaccgcgtcgagcgcggtgaatcggtgttggtggtc
gagtccgataaggccgacatggacgtggagtcctttgaagccggcttcctcggtgctgtg
ttgctgcccgctggcggcacagcgcctgtgggcgaaaccatcggtttggtggtggaaacc
gaggctgagctcgccgaactcaaggccaacggcccagccaaaccagccgcttctgcgcct
gcagcagcaccggccccagcaccagctgctgcacccccagcggcccctgagcccgccccc
gcgccaacccctgcgccggttgccgtggccgctccgcctgcccctgccagcagcaatggc
catggcggacgtgtcgtggcgagcccccgcgccaagaaactggcccagcaattgggcgtg
caactcgagggcctgcgcggcagcggcccccatggccgcctgatcgctgctgatatcgag
cgtgctgccggtcgcacccccaccgcgccagcggctgttccagctggaaccctgacggcg
gcgcaagctgctgcccctgctgtggctccgctgccagcagctgtggctgccccagtagcg
cctggtgaaaccctgcccttcaccaccttgcagcaggcggtcaaccgcaacatggtggcc
agcctggcggtgcccaccttccgcgtcggctacacgatcaccaccgacaagctcgacgcc
ttctataagcaggtcaagcccaagggcgtgaccatgaccgcacttttggccaaggctgtg
gcgtctgctctggccggccaccccagggtgaatgcggccttcagcgaggccggcatcgct
tatccagagggcatcaatgtggccgtagctgtggccatggaagacggcggcttggtgacc
ccggtgctggccgccgctgatcgcaacgacctttacagcctctcgcgcagctgggctgat
ctggtctctcgggcccgcagcaagcagttgaagcctgaggaatacagcactggcaccttc
accctctccaatctgggcatgtttggtgtcgaccgctttgacgcgatcctgccgccaggc
accggcgcaatcctggctgtgggtgcctcacgtccagtggtggccgccaacagcgatggc
tcgatcgccgtcaagcgccagatgcaggtcaacctcaccgcagaccaccgcgtgatctac
ggcgctgatgctgccggcttcctcaaggatctggccaagatcatcgaaacccagcccgaa
agcctggcgctttga

DBGET integrated database retrieval system