KEGG   Synechococcus sp. RCC307: SynRCC307_2090Help
Entry
SynRCC307_2090    CDS       T00523                                 

Gene name
ppc, pepC
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
syr  Synechococcus sp. RCC307
Pathway
syr00620  Pyruvate metabolism
syr00680  Methane metabolism
syr00710  Carbon fixation in photosynthetic organisms
syr01100  Metabolic pathways
syr01120  Microbial metabolism in diverse environments
syr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SynRCC307_2090 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SynRCC307_2090 (ppc)
   00680 Methane metabolism
    SynRCC307_2090 (ppc)
Enzymes [BR:syr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SynRCC307_2090 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CAK28993
CyanoBase: SynRCC307_2090
CYORF: SynRCC307_2090
UniProt: A5GVT4
LinkDB All DBs
Position
1807023..1810001
Genome map
AA seq 992 aa AA seqDB search
MIETSSTASTSRMPASQTETVQPVGRRTLRQLNERLELVEELWGNVLRSECPPEQAARVL
QLKQLCREDETSDQIIDLIVAMDLSEAIAAARAFSLYFQLVNILEQHIEEDRYLATMSQD
NIAEAAISDTLNGHLANHDQPATFQRLFQRLRALNVPPGLLEPLLRELDVRLVFTAHPTE
IVRHTVRHKHRRVAHLIQRLEGLNDENDSFDDRQGLRQQLLEEIRVWWRTDELHQFKPSV
LDEVDYALHFFQQVLFQAMPLLHERIRKALKDSYPDVTPPEDGFCTFGSWVGSDRDGNPS
VTPEITWRTACYQRQLMLERYLSSVRNLRNQLSISMQWSQVSPALLESLEMDRLRFPEIY
EKLAARYRLEPYRLKLCYVLQRLELTHERNAQLSELGWESPLSATEPEEQTLSSSLTPQQ
ELHYSTYQDFRSDLELVRTSLEATGLSCEPLNRLLSQVQIFGFCLASLDIRQESTRHSEA
LAELTRYLQLPQDYEAMEEPQRVEWLLEQLQTRRPLIPTGPLWSDATAETFAVFQMLRRL
QEEFGQRICRTYVISMSHTESDLLEVLLLAKEAGLVDPVEGTTRLQVIPLFETVEDLRCA
PEVMGAVMARPFYKRLLANEEVPLQEVMLGYSDSNKDSGFLSSNWEIHRAQIALQSLCSE
HNISLRIFHGRGGSVSRGGGPAYQAILAQPSGTLKGRIKITEQGEVLASKYALPELALYN
LETVTTAVLQNSLLSSGVDDTPSWNELMERLASRSRQHYRALVHEHPDLVAFFEQVTPIE
EISKLQISSRPARRRTGARDLSSLRAIPWVFGWTQSRFLLPSWFGVGAAIREELGDDGEQ
LDTLRTLYQRWPFFRMLISKVEMTLAKVDLSLAKYYVDSLGSADRADAFQEIFATIAAEY
SLTKELVLKITGHERLLDGDPPLQLSVELRNRTIVPLGFLQVALLRRLRNQNRQPPMNES
DLSDTRTYSRGELLRGALLTINGIAAGLRNTG
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaacgtcttccactgcttcgacctcgcgcatgccggcttcgcagaccgagaca
gtccagcccgtcggtcgccgcacgctgcgtcagctgaacgaacgcttggagctggtcgaa
gagctgtggggcaacgtgctgcgcagcgaatgcccgcctgagcaggccgcacgagtgctt
cagctcaagcagctctgccgcgaagacgagacctccgatcagatcatcgacctgatcgtg
gcgatggatctctcggaagcgatcgctgctgccagggctttttccctctatttccaactg
gtcaacatcctcgagcagcacatcgaggaagaccgctacctggccacgatgagccaggac
aacatcgcggaagccgcgatcagcgacaccctcaatggccacctggccaaccacgaccag
cccgccaccttccagcggctgttccagcggctgcgcgccctcaatgtgccccccgggcta
ctcgagcccctgctgcgggagcttgatgtgcggctggtgtttaccgcgcaccccaccgag
attgttcgccacacggtgcgccacaagcaccgccgcgtcgcccatctgattcagcgcctg
gaagggttgaacgacgaaaacgacagctttgatgatcgccaggggttgcgccagcagctg
ctcgaagagatccgcgtctggtggcgcaccgatgaactgcatcagttcaaaccatcggtg
ctcgatgaggtggattacgccctgcacttcttccagcaggtgctgttccaggcgatgcca
ctgctgcatgaacgcatccgcaaggcactgaaggactcctatcccgatgtgacaccgccg
gaagacgggttctgcaccttcggctcatgggtgggctccgaccgcgatggcaacccctcg
gtcacaccggagatcacctggcgcaccgcctgttaccagcgccagttgatgctggagcgc
tacctgagctcggtgcgcaacctgcgcaaccagctgagcatttccatgcaatggagccag
gtgagtccggcactgctggagtccctcgagatggaccggctgcggttcccggagatctac
gaaaaactggcggctcgctaccgccttgagccctaccggctgaagctctgctacgtgctg
cagcgcctggagctcacccacgagcgcaacgcgcaactgtctgaattgggctgggaatct
cccctcagcgccaccgaaccggaggaacagaccctcagcagcagcctgaccccacagcag
gagctgcactacagcacctaccaggacttccgaagtgatctggaactggttcgcaccagc
ctggaagccaccggcttgagctgcgaaccgctgaatcgcctgctcagccaggtgcagatc
tttgggttctgtctggcctccctcgatattcgccaggagagcacccgccatagcgaagcc
cttgccgagctcacccgctacctgcaactacctcaggactatgaggccatggaggagcct
cagcgggtggagtggctgctggagcagctgcaaaccaggcggccactgattcccaccggt
ccgctttggagtgatgccacggcggaaacctttgccgtcttccaaatgctgcggcggctc
caggaggaatttgggcagcggatttgccgcacctatgtgatctccatgagtcacacggag
tcggatctgctggaggtgctgctgctagccaaagaggccggcttggtggatccggtggaa
ggcaccacacgcctgcaggtgattccactgtttgaaacggtggaagacttgcgctgcgcc
cctgaggtgatgggcgctgtgatggctcgccccttctacaagcgactgctcgccaacgag
gaggtgccgctgcaggaggtgatgctcggctactccgatagcaacaaagactccggcttc
ctctccagcaactgggaaatccaccgggcccaaatcgccctgcaatcgctgtgcagtgag
cacaacatcagcctgcgcatcttccacggacgcggcggctcggtgagccgtggtggtggc
ccggcgtatcaagcgatcctggcccagccgagcggcaccctcaaaggccggatcaagatc
accgaacaaggggaggtgctggcctcgaagtacgccctgccggaactagcgctctacaac
ctcgagacggtaaccaccgctgtgcttcaaaacagcttgctctccagtggcgtggacgac
acccccagctggaatgagctgatggaacggctggcttcacgctcgcgtcagcactaccgc
gccctggtgcatgagcacccggatctggtggccttctttgagcaggtcaccccgattgaa
gaaatcagcaagctgcaaatcagctcgaggccggcacggcgccgcacgggcgcccgggat
ctgtcctcactgcgggccattccttgggtgttcggctggacccaaagccgcttcctgctg
cccagctggtttggtgtgggcgccgccatccgcgaggaattgggtgacgacggtgagcag
ctcgacaccctgcgcaccctctaccagcgctggcccttcttccgcatgctgatcagcaag
gtggagatgaccctggcgaaggtggacctgtccttggcgaagtactacgtcgactccctt
ggcagtgctgaccgcgccgatgccttccaagagatcttcgccaccatcgctgccgagtac
agcctcaccaaggagctggtgctcaagatcaccggccatgaacgactgctcgatggcgac
ccaccgctgcaactctcggtggagttgcgcaatcggacgatcgtgcccctgggctttttg
caagtggccctgctgcggaggctccgcaaccagaaccgccagccccccatgaatgaatcc
gatctgagcgatacgcgcacctacagccggggtgagctgctgcgcggtgccttgctcacc
atcaacggaattgccgctggcctgcgcaacaccggttga

DBGET integrated database retrieval system