KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_0460Help
Entry
SYNPCCN_0460      CDS       T01778                                 

Gene name
envM
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
sys00061  Fatty acid biosynthesis
sys00780  Biotin metabolism
sys01100  Metabolic pathways
sys01130  Biosynthesis of antibiotics
sys01212  Fatty acid metabolism
Module
sys_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sys00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SYNPCCN_0460 (envM)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SYNPCCN_0460 (envM)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SYNPCCN_0460 (envM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sys01004]
    SYNPCCN_0460 (envM)
Enzymes [BR:sys01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SYNPCCN_0460 (envM)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SYNPCCN_0460 (envM)
Lipid biosynthesis proteins [BR:sys01004]
 Fatty acid synthase
  Component type
   SYNPCCN_0460 (envM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short DUF1598
Motif
Other DBs
NCBI-ProteinID: BAL31377
LinkDB All DBs
Position
504033..504809
Genome map
AA seq 258 aa AA seqDB search
MLDLSGKHAFVTGIANNRSIAWGIAQQLHQAGAEIGVSYLPDEKGRFEKKVRELTEPLHP
TLVLPGDVQDDAQVDALFHSVKEKWGKLDILIHCLAFADKSGLTGNYTDIPKEAFSQAME
ISTYSLGRLARGAKPLMTNGGSIITLTYFGGVKVIPNYNLMGVAKAGLEMTVRYLAAELG
PQNIRVNGISAGPIRTLASSAVGGILDMIHHVEEVAPLKRTVTQTEVGNTAAFLASDLSS
GITGQIIYVDSGYEIMGM
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttagatctcagcggcaagcacgcctttgttaccggcatcgccaataatcgctccatt
gcctggggcattgcccaacaactacaccaggccggggctgaaattggcgttagttatctt
ccagatgagaaaggcagatttgaaaagaaagtgcgggagttgaccgagcctttgcatcct
accctcgtcttgccgggggacgtacaggacgatgcccaggtggatgccctgttccatagc
gttaaggaaaaatggggcaaactcgatattttgatccattgcttagcctttgccgacaag
tccggtttgacggggaattataccgatattcccaaggaagcctttagtcaagcaatggaa
attagcacctattccctggggcgtttggctcggggggcaaaacccttgatgaccaatggc
ggtagcatcattaccctgacttactttggcggcgtgaaggttattcccaactacaacctg
atgggggtggcgaaggccggtctggaaatgactgtgcgttatctggccgcagaattgggg
ccccaaaatattcgtgttaatggtatttccgctggccccatccggaccctggcttcttcg
gcggtggggggcattttggatatgattcaccatgtggaagaggtggcaccactaaagcgt
accgtcacccaaacggaagtggggaatacagcggctttcctggccagtgacctttccagt
ggcattaccggacaaattatctacgtcgattctggctatgaaattatgggtatgtaa

DBGET integrated database retrieval system